Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NG28

Protein Details
Accession A0A1E3NG28   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-138EAETTPEPIQKKKKNKKKGKKBasic
NLS Segment(s)
PositionSequence
127-138QKKKKNKKKGKK
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MKVKQIDTYITSTHSLLKSNPSGTTISITYTHVKKDDDKIRSIIKFKTYDSKNGICHVFKTHKVKEFSKLFNALGPRGCNVDGQDVDGLSLLLSNTDKDLVIKEVSECVPSNEKIKVEAETTPEPIQKKKKNKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.27
5 0.28
6 0.29
7 0.29
8 0.26
9 0.25
10 0.24
11 0.26
12 0.19
13 0.17
14 0.16
15 0.18
16 0.21
17 0.22
18 0.23
19 0.23
20 0.24
21 0.26
22 0.34
23 0.4
24 0.39
25 0.4
26 0.42
27 0.46
28 0.47
29 0.47
30 0.41
31 0.38
32 0.37
33 0.35
34 0.41
35 0.37
36 0.39
37 0.42
38 0.43
39 0.38
40 0.4
41 0.41
42 0.32
43 0.31
44 0.3
45 0.28
46 0.3
47 0.36
48 0.37
49 0.41
50 0.46
51 0.46
52 0.49
53 0.5
54 0.47
55 0.43
56 0.4
57 0.33
58 0.31
59 0.31
60 0.24
61 0.2
62 0.18
63 0.15
64 0.14
65 0.15
66 0.13
67 0.13
68 0.15
69 0.13
70 0.14
71 0.13
72 0.12
73 0.11
74 0.1
75 0.09
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.08
87 0.1
88 0.1
89 0.1
90 0.1
91 0.13
92 0.13
93 0.16
94 0.15
95 0.16
96 0.2
97 0.21
98 0.24
99 0.24
100 0.24
101 0.24
102 0.25
103 0.24
104 0.21
105 0.22
106 0.25
107 0.25
108 0.28
109 0.29
110 0.32
111 0.32
112 0.39
113 0.47
114 0.51
115 0.59
116 0.66
117 0.74
118 0.81