Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5I9H1

Protein Details
Accession A0A2P5I9H1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
153-172EAGLAQRRRPGRPRKQPASGHydrophilic
NLS Segment(s)
PositionSequence
132-171RRPARARQERAVGASSKANGGEAGLAQRRRPGRPRKQPAS
Subcellular Location(s) nucl 14, mito 4, cyto 4, pero 4, cyto_mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001370  BIR_rpt  
Pfam View protein in Pfam  
PF00653  BIR  
PROSITE View protein in PROSITE  
PS50143  BIR_REPEAT_2  
CDD cd00022  BIR  
Amino Acid Sequences MPPKMPKIDCDVEQYLQFHNRLASFVDWNLDWELNGDKPSPEDLARAGFFSWTKPPYDPDNVMCPYCRLALDNWDPKDDPQREHKLRSRHCDFVRDRQKVRDMGKDAGGPPPTSTPNGPGKKQNGTSDTGTRRPARARQERAVGASSKANGGEAGLAQRRRPGRPRKQPASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.35
4 0.33
5 0.27
6 0.25
7 0.24
8 0.21
9 0.23
10 0.21
11 0.18
12 0.19
13 0.19
14 0.16
15 0.18
16 0.19
17 0.16
18 0.14
19 0.13
20 0.14
21 0.13
22 0.14
23 0.13
24 0.11
25 0.13
26 0.14
27 0.15
28 0.14
29 0.13
30 0.13
31 0.16
32 0.16
33 0.16
34 0.14
35 0.13
36 0.13
37 0.14
38 0.18
39 0.16
40 0.18
41 0.18
42 0.21
43 0.25
44 0.3
45 0.3
46 0.28
47 0.33
48 0.33
49 0.32
50 0.29
51 0.25
52 0.21
53 0.19
54 0.17
55 0.11
56 0.1
57 0.17
58 0.24
59 0.3
60 0.29
61 0.3
62 0.3
63 0.3
64 0.38
65 0.34
66 0.29
67 0.3
68 0.4
69 0.41
70 0.47
71 0.52
72 0.52
73 0.56
74 0.62
75 0.58
76 0.56
77 0.54
78 0.57
79 0.55
80 0.56
81 0.61
82 0.58
83 0.55
84 0.52
85 0.56
86 0.53
87 0.52
88 0.49
89 0.43
90 0.39
91 0.39
92 0.37
93 0.32
94 0.31
95 0.29
96 0.22
97 0.19
98 0.19
99 0.19
100 0.18
101 0.18
102 0.19
103 0.27
104 0.32
105 0.33
106 0.38
107 0.4
108 0.45
109 0.49
110 0.5
111 0.43
112 0.43
113 0.44
114 0.45
115 0.46
116 0.44
117 0.45
118 0.42
119 0.43
120 0.44
121 0.47
122 0.5
123 0.55
124 0.59
125 0.59
126 0.64
127 0.63
128 0.6
129 0.57
130 0.48
131 0.39
132 0.35
133 0.29
134 0.23
135 0.2
136 0.18
137 0.14
138 0.12
139 0.11
140 0.09
141 0.14
142 0.19
143 0.21
144 0.22
145 0.28
146 0.33
147 0.39
148 0.48
149 0.54
150 0.59
151 0.69
152 0.79