Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5I5N6

Protein Details
Accession A0A2P5I5N6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-70IHFATMKPEQKKKKEKGAKGGAKKBasic
NLS Segment(s)
PositionSequence
55-70EQKKKKEKGAKGGAKK
Subcellular Location(s) plas 8, cyto 6, E.R. 6, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFSKIGATPQAVAALNDQPYLFTILIVVLLILILEGVFIWYIHFATMKPEQKKKKEKGAKGGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.17
5 0.17
6 0.16
7 0.15
8 0.15
9 0.14
10 0.11
11 0.11
12 0.14
13 0.12
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.04
34 0.04
35 0.05
36 0.05
37 0.1
38 0.18
39 0.26
40 0.33
41 0.42
42 0.52
43 0.62
44 0.73
45 0.76
46 0.79
47 0.82
48 0.83
49 0.85
50 0.87