Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2B287

Protein Details
Accession H2B287    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-116PKDLRAKKTRALRRKLTKFEASRITEKQRKKQIAFPQRKYHydrophilic
NLS Segment(s)
PositionSequence
71-114KGKKYQPKDLRAKKTRALRRKLTKFEASRITEKQRKKQIAFPQR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG kaf:KAFR_0L01280  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGLKGYELRTKSKDELESQLIDLKKELAELKVQKLSRPSLPKIKTVRKNIARVLTIINEQQRNAVRELYKGKKYQPKDLRAKKTRALRRKLTKFEASRITEKQRKKQIAFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.46
4 0.44
5 0.42
6 0.37
7 0.39
8 0.33
9 0.28
10 0.25
11 0.2
12 0.15
13 0.16
14 0.16
15 0.12
16 0.18
17 0.21
18 0.25
19 0.3
20 0.3
21 0.31
22 0.34
23 0.36
24 0.36
25 0.39
26 0.4
27 0.43
28 0.45
29 0.51
30 0.55
31 0.62
32 0.63
33 0.65
34 0.7
35 0.67
36 0.7
37 0.67
38 0.63
39 0.54
40 0.46
41 0.4
42 0.31
43 0.25
44 0.22
45 0.22
46 0.17
47 0.16
48 0.19
49 0.2
50 0.2
51 0.2
52 0.21
53 0.18
54 0.21
55 0.28
56 0.31
57 0.33
58 0.34
59 0.4
60 0.45
61 0.48
62 0.55
63 0.57
64 0.61
65 0.66
66 0.74
67 0.78
68 0.78
69 0.8
70 0.76
71 0.77
72 0.77
73 0.76
74 0.75
75 0.74
76 0.77
77 0.81
78 0.83
79 0.8
80 0.79
81 0.73
82 0.72
83 0.7
84 0.65
85 0.61
86 0.59
87 0.62
88 0.6
89 0.64
90 0.67
91 0.68
92 0.72
93 0.7
94 0.73
95 0.74
96 0.78
97 0.81
98 0.79
99 0.79
100 0.77