Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5IFX6

Protein Details
Accession A0A2P5IFX6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-70VEDENGRRRRKRRVQQQSQEVQGHydrophilic
NLS Segment(s)
PositionSequence
54-60RRRRKRR
Subcellular Location(s) mito 10extr 10, plas 3, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPHLHPRSRMTSSLFATTMLASFVVVGLPHILPCPAPRVTYADGEIVEDENGRRRRKRRVQQQSQEVQGGVVQLNNITRADLVGHEGNRGKRECPVPKPGGKVGELLGFKQTSKPQTTDSNTQDRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.26
6 0.2
7 0.14
8 0.11
9 0.06
10 0.06
11 0.06
12 0.05
13 0.04
14 0.04
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.12
23 0.12
24 0.12
25 0.13
26 0.18
27 0.2
28 0.22
29 0.22
30 0.19
31 0.18
32 0.18
33 0.17
34 0.12
35 0.1
36 0.08
37 0.08
38 0.14
39 0.2
40 0.24
41 0.3
42 0.34
43 0.45
44 0.56
45 0.66
46 0.69
47 0.74
48 0.81
49 0.84
50 0.89
51 0.82
52 0.74
53 0.64
54 0.53
55 0.41
56 0.31
57 0.22
58 0.13
59 0.08
60 0.06
61 0.05
62 0.06
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.09
71 0.11
72 0.11
73 0.14
74 0.18
75 0.2
76 0.24
77 0.25
78 0.23
79 0.26
80 0.34
81 0.39
82 0.41
83 0.49
84 0.51
85 0.55
86 0.59
87 0.58
88 0.54
89 0.47
90 0.42
91 0.35
92 0.34
93 0.3
94 0.25
95 0.24
96 0.21
97 0.21
98 0.24
99 0.28
100 0.29
101 0.33
102 0.34
103 0.35
104 0.43
105 0.5
106 0.54
107 0.55
108 0.59