Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5I2X6

Protein Details
Accession A0A2P5I2X6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
138-163SGPSGSKWQRGQRRPNKPRREASAEDHydrophilic
NLS Segment(s)
PositionSequence
148-156GQRRPNKPR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR006600  HTH_CenpB_DNA-bd_dom  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF05225  HTH_psq  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MDSSIEPEEQPGTESRVTADSDKWEPNIKAALEAIEEGRMSYRQARDAYGISVTTLTRRRNGAKPRHEVQLLSRKMTPAMEDSVVHWTLWERRNNRPPTQAQVRQYAQHVCDVSGLSTKIGKNWLDRFIPRHPELLESGPSGSKWQRGQRRPNKPRREASAEDSGEAAEVQTPLSREENVSASQVTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.21
5 0.21
6 0.21
7 0.22
8 0.25
9 0.28
10 0.28
11 0.32
12 0.3
13 0.31
14 0.33
15 0.28
16 0.25
17 0.23
18 0.22
19 0.16
20 0.17
21 0.14
22 0.1
23 0.1
24 0.09
25 0.1
26 0.09
27 0.1
28 0.15
29 0.17
30 0.21
31 0.22
32 0.24
33 0.25
34 0.26
35 0.25
36 0.2
37 0.18
38 0.13
39 0.13
40 0.12
41 0.14
42 0.19
43 0.19
44 0.21
45 0.25
46 0.3
47 0.38
48 0.47
49 0.53
50 0.56
51 0.62
52 0.62
53 0.63
54 0.59
55 0.52
56 0.49
57 0.49
58 0.42
59 0.36
60 0.34
61 0.29
62 0.29
63 0.28
64 0.22
65 0.14
66 0.14
67 0.13
68 0.12
69 0.13
70 0.16
71 0.16
72 0.14
73 0.12
74 0.11
75 0.16
76 0.21
77 0.26
78 0.26
79 0.34
80 0.44
81 0.49
82 0.51
83 0.52
84 0.49
85 0.5
86 0.56
87 0.54
88 0.47
89 0.49
90 0.47
91 0.42
92 0.42
93 0.38
94 0.3
95 0.27
96 0.25
97 0.18
98 0.17
99 0.16
100 0.14
101 0.13
102 0.12
103 0.09
104 0.12
105 0.12
106 0.12
107 0.16
108 0.17
109 0.21
110 0.24
111 0.28
112 0.29
113 0.31
114 0.34
115 0.37
116 0.43
117 0.39
118 0.39
119 0.35
120 0.34
121 0.34
122 0.32
123 0.27
124 0.2
125 0.2
126 0.17
127 0.17
128 0.18
129 0.18
130 0.2
131 0.24
132 0.32
133 0.42
134 0.5
135 0.62
136 0.68
137 0.78
138 0.84
139 0.89
140 0.91
141 0.9
142 0.89
143 0.87
144 0.85
145 0.78
146 0.73
147 0.73
148 0.63
149 0.54
150 0.45
151 0.36
152 0.28
153 0.22
154 0.16
155 0.08
156 0.07
157 0.07
158 0.09
159 0.1
160 0.12
161 0.14
162 0.15
163 0.15
164 0.18
165 0.21
166 0.2
167 0.22