Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AUA6

Protein Details
Accession H2AUA6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
188-212YLNKIHDAKVREKNKKERKKIVKTLBasic
NLS Segment(s)
PositionSequence
196-210KVREKNKKERKKIVK
Subcellular Location(s) nucl 10, plas 6, mito_nucl 6, cyto 4, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG kaf:KAFR_0D03080  -  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MFEIEINEPLKIKLQELNETTKRDEFNTEINSYLQKKSIPISALLDFYETYWKDAIRLKDLLTPFDFKFKEKYVPGSGYSTEFKKQLELLSLKEQELEYQTMIRNDKSITLQTMNMDNDNLTMSKINKQIKEQITTIFNILISVLSVIWAIWYWSKSSAGLAIHYRILLCLFFGLLVLIAEVVLYKSYLNKIHDAKVREKNKKERKKIVKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.35
4 0.44
5 0.43
6 0.46
7 0.47
8 0.46
9 0.44
10 0.38
11 0.39
12 0.32
13 0.34
14 0.36
15 0.33
16 0.3
17 0.3
18 0.33
19 0.32
20 0.31
21 0.26
22 0.22
23 0.22
24 0.23
25 0.27
26 0.23
27 0.22
28 0.24
29 0.24
30 0.24
31 0.22
32 0.21
33 0.16
34 0.15
35 0.2
36 0.16
37 0.16
38 0.16
39 0.16
40 0.17
41 0.22
42 0.25
43 0.23
44 0.24
45 0.23
46 0.28
47 0.29
48 0.29
49 0.26
50 0.27
51 0.23
52 0.29
53 0.29
54 0.25
55 0.28
56 0.27
57 0.31
58 0.29
59 0.34
60 0.31
61 0.33
62 0.33
63 0.31
64 0.29
65 0.26
66 0.27
67 0.24
68 0.21
69 0.2
70 0.18
71 0.17
72 0.17
73 0.15
74 0.18
75 0.18
76 0.19
77 0.24
78 0.25
79 0.24
80 0.24
81 0.22
82 0.18
83 0.18
84 0.16
85 0.1
86 0.1
87 0.11
88 0.13
89 0.15
90 0.14
91 0.13
92 0.12
93 0.13
94 0.13
95 0.13
96 0.12
97 0.12
98 0.13
99 0.13
100 0.16
101 0.15
102 0.14
103 0.13
104 0.11
105 0.1
106 0.1
107 0.09
108 0.06
109 0.07
110 0.08
111 0.13
112 0.2
113 0.24
114 0.26
115 0.28
116 0.36
117 0.38
118 0.41
119 0.37
120 0.34
121 0.31
122 0.3
123 0.28
124 0.2
125 0.16
126 0.12
127 0.11
128 0.07
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.06
139 0.07
140 0.08
141 0.1
142 0.11
143 0.11
144 0.11
145 0.14
146 0.13
147 0.15
148 0.16
149 0.16
150 0.16
151 0.16
152 0.16
153 0.13
154 0.13
155 0.1
156 0.08
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.05
173 0.07
174 0.12
175 0.17
176 0.2
177 0.27
178 0.3
179 0.38
180 0.44
181 0.47
182 0.52
183 0.57
184 0.64
185 0.68
186 0.74
187 0.77
188 0.82
189 0.88
190 0.9
191 0.91
192 0.92