Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HUF7

Protein Details
Accession A0A2P5HUF7   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-49SATQWSKSNSRMRKKKKKEKKKKKKASSLHIQYGHydrophilic
NLS Segment(s)
PositionSequence
25-41SRMRKKKKKEKKKKKKA
Subcellular Location(s) nucl 18, cyto 5.5, cyto_mito 4.5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MPNVAMHLTDITSADSATQWSKSNSRMRKKKKKEKKKKKKASSLHIQYGIDLNTPMVERAVQNAVKGLTPLEDLDSLGASGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.1
5 0.12
6 0.12
7 0.15
8 0.18
9 0.25
10 0.34
11 0.42
12 0.51
13 0.6
14 0.69
15 0.77
16 0.86
17 0.9
18 0.92
19 0.94
20 0.95
21 0.96
22 0.97
23 0.97
24 0.97
25 0.96
26 0.95
27 0.93
28 0.9
29 0.89
30 0.85
31 0.79
32 0.72
33 0.61
34 0.5
35 0.43
36 0.34
37 0.24
38 0.16
39 0.1
40 0.07
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.09
47 0.14
48 0.14
49 0.14
50 0.16
51 0.16
52 0.16
53 0.16
54 0.14
55 0.1
56 0.1
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1