Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AQ65

Protein Details
Accession H2AQ65    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
81-110ARIVRVRSRVNRRIRTPPQRPRFNRDSKVSHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRASNGRNKKGRGHVK
91-102NRRIRTPPQRPR
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG kaf:KAFR_0B02170  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSKSVPKDKAIKRMAIRNIVEAAAVRDLSEASVYSEYALPKTYNKLHYCVSCAIHARIVRVRSRVNRRIRTPPQRPRFNRDSKVSPADAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.66
11 0.61
12 0.62
13 0.58
14 0.54
15 0.55
16 0.58
17 0.59
18 0.61
19 0.66
20 0.61
21 0.66
22 0.64
23 0.61
24 0.55
25 0.6
26 0.58
27 0.56
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.08
48 0.08
49 0.08
50 0.09
51 0.08
52 0.09
53 0.13
54 0.17
55 0.23
56 0.25
57 0.27
58 0.29
59 0.3
60 0.32
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.28
72 0.3
73 0.36
74 0.41
75 0.5
76 0.56
77 0.63
78 0.68
79 0.7
80 0.77
81 0.8
82 0.82
83 0.83
84 0.85
85 0.85
86 0.87
87 0.87
88 0.85
89 0.85
90 0.84
91 0.82
92 0.79
93 0.75
94 0.72
95 0.72
96 0.65
97 0.58
98 0.54
99 0.53