Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5HMC4

Protein Details
Accession A0A2P5HMC4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-97RDHVLRTPYPPKDRKHKRLPAGSBasic
NLS Segment(s)
PositionSequence
86-93KDRKHKRL
Subcellular Location(s) nucl 9, mito 8, extr 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MLTIFILHLGPVSHHHVVYRQNSLSLLNLVLGLSFYLDSGLAHLPRSSTCCFNRARDTSGYQAPKHPTIPAQARRDHVLRTPYPPKDRKHKRLPAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.23
4 0.29
5 0.33
6 0.36
7 0.3
8 0.29
9 0.29
10 0.29
11 0.27
12 0.21
13 0.16
14 0.1
15 0.09
16 0.08
17 0.07
18 0.06
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.04
25 0.03
26 0.05
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.08
33 0.12
34 0.12
35 0.16
36 0.17
37 0.21
38 0.23
39 0.27
40 0.34
41 0.32
42 0.35
43 0.32
44 0.34
45 0.34
46 0.38
47 0.38
48 0.32
49 0.35
50 0.35
51 0.35
52 0.33
53 0.3
54 0.25
55 0.29
56 0.38
57 0.41
58 0.43
59 0.44
60 0.46
61 0.5
62 0.5
63 0.45
64 0.41
65 0.4
66 0.37
67 0.41
68 0.48
69 0.52
70 0.6
71 0.64
72 0.66
73 0.7
74 0.78
75 0.8
76 0.82
77 0.84