Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HL13

Protein Details
Accession A0A2P5HL13    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-105PQALSPRPLHRPRRRRDRSQARYHRQPLRGQBasic
NLS Segment(s)
PositionSequence
34-120RPRRGGQLVGAEPGRERHLIREHRGRALRHLGRGPVQARRGPQALSPRPLHRPRRRRDRSQARYHRQPLRGQQHGAAPPRRQPGERH
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
Amino Acid Sequences MGQGDPSRLQHCIRRSRPVTGCCARGPSAEARYRPRRGGQLVGAEPGRERHLIREHRGRALRHLGRGPVQARRGPQALSPRPLHRPRRRRDRSQARYHRQPLRGQQHGAAPPRRQPGERHRGCWGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.64
4 0.69
5 0.66
6 0.67
7 0.62
8 0.6
9 0.51
10 0.52
11 0.43
12 0.36
13 0.35
14 0.32
15 0.34
16 0.36
17 0.38
18 0.43
19 0.5
20 0.54
21 0.54
22 0.52
23 0.51
24 0.49
25 0.5
26 0.45
27 0.43
28 0.39
29 0.38
30 0.34
31 0.27
32 0.24
33 0.21
34 0.19
35 0.13
36 0.13
37 0.15
38 0.24
39 0.29
40 0.35
41 0.43
42 0.43
43 0.48
44 0.53
45 0.48
46 0.44
47 0.49
48 0.45
49 0.39
50 0.38
51 0.33
52 0.3
53 0.34
54 0.32
55 0.27
56 0.28
57 0.27
58 0.26
59 0.28
60 0.27
61 0.23
62 0.25
63 0.3
64 0.31
65 0.35
66 0.37
67 0.37
68 0.45
69 0.53
70 0.61
71 0.61
72 0.67
73 0.72
74 0.79
75 0.85
76 0.86
77 0.88
78 0.89
79 0.89
80 0.9
81 0.91
82 0.89
83 0.91
84 0.89
85 0.87
86 0.81
87 0.78
88 0.77
89 0.75
90 0.72
91 0.64
92 0.58
93 0.57
94 0.58
95 0.59
96 0.55
97 0.5
98 0.5
99 0.57
100 0.57
101 0.52
102 0.54
103 0.57
104 0.62
105 0.65
106 0.62