Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5I7U1

Protein Details
Accession A0A2P5I7U1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
63-86ELLRNSRDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
67-90NSRDKRARKLAKKRLGTFGRAKKK
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKEATARSGLIVGINKGHKTTPRVVKPRVSRTKGHLSKRTAFVRDIVKEVAGLAPYEKRVIELLRNSRDKRARKLAKKRLGTFGRAKKKVDELQRVIAESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.21
4 0.21
5 0.23
6 0.25
7 0.28
8 0.36
9 0.41
10 0.49
11 0.56
12 0.6
13 0.66
14 0.7
15 0.76
16 0.77
17 0.71
18 0.65
19 0.64
20 0.71
21 0.7
22 0.7
23 0.67
24 0.62
25 0.64
26 0.67
27 0.65
28 0.56
29 0.49
30 0.44
31 0.42
32 0.37
33 0.33
34 0.26
35 0.21
36 0.18
37 0.18
38 0.14
39 0.08
40 0.07
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.13
50 0.19
51 0.26
52 0.32
53 0.4
54 0.4
55 0.47
56 0.54
57 0.56
58 0.58
59 0.61
60 0.65
61 0.69
62 0.79
63 0.81
64 0.83
65 0.86
66 0.82
67 0.82
68 0.76
69 0.72
70 0.71
71 0.7
72 0.71
73 0.67
74 0.65
75 0.59
76 0.63
77 0.63
78 0.63
79 0.63
80 0.58
81 0.62
82 0.62
83 0.59
84 0.53
85 0.5
86 0.43