Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2ASE9

Protein Details
Accession H2ASE9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LSKTYGSTVSRKKKNNKERETSKGTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
KEGG kaf:KAFR_0C03070  -  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSLHSYLSKTYGSTVSRKKKNNKERETSKGTSLQITENNTEVQQISNPTTNPPAKGLWKDVRTNEVFSLPKVEGDNTVSTDEEKSVFKPKGNETVHRDEKGHKLTSEQLKSKEKEQDLRVQIKKRYLQRLNAGELQLYLKENNTTLESLLRSRGNPYISSEDPQESFNTKSKPENNLSLLNRKLYNGISPENRFDIKPGYRWDGVDRSNGFEEKWFRKRNEIEEKKIQKATSQNDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.57
4 0.66
5 0.73
6 0.79
7 0.86
8 0.89
9 0.88
10 0.89
11 0.88
12 0.88
13 0.86
14 0.79
15 0.73
16 0.68
17 0.6
18 0.52
19 0.46
20 0.4
21 0.36
22 0.37
23 0.33
24 0.28
25 0.27
26 0.24
27 0.23
28 0.19
29 0.16
30 0.14
31 0.15
32 0.17
33 0.19
34 0.19
35 0.2
36 0.27
37 0.29
38 0.28
39 0.27
40 0.27
41 0.29
42 0.32
43 0.38
44 0.38
45 0.41
46 0.45
47 0.45
48 0.48
49 0.45
50 0.44
51 0.38
52 0.35
53 0.31
54 0.26
55 0.28
56 0.21
57 0.2
58 0.19
59 0.18
60 0.14
61 0.16
62 0.17
63 0.15
64 0.16
65 0.14
66 0.14
67 0.14
68 0.13
69 0.11
70 0.11
71 0.11
72 0.17
73 0.19
74 0.2
75 0.24
76 0.26
77 0.35
78 0.37
79 0.42
80 0.42
81 0.5
82 0.53
83 0.5
84 0.49
85 0.42
86 0.46
87 0.44
88 0.4
89 0.3
90 0.27
91 0.32
92 0.39
93 0.42
94 0.38
95 0.39
96 0.43
97 0.44
98 0.47
99 0.47
100 0.41
101 0.42
102 0.41
103 0.44
104 0.43
105 0.5
106 0.5
107 0.49
108 0.49
109 0.49
110 0.52
111 0.5
112 0.55
113 0.51
114 0.52
115 0.54
116 0.55
117 0.53
118 0.5
119 0.44
120 0.34
121 0.3
122 0.25
123 0.17
124 0.14
125 0.1
126 0.08
127 0.08
128 0.08
129 0.09
130 0.1
131 0.1
132 0.09
133 0.11
134 0.11
135 0.12
136 0.15
137 0.15
138 0.14
139 0.16
140 0.19
141 0.19
142 0.19
143 0.22
144 0.25
145 0.25
146 0.26
147 0.26
148 0.24
149 0.23
150 0.23
151 0.21
152 0.17
153 0.19
154 0.23
155 0.23
156 0.24
157 0.3
158 0.35
159 0.4
160 0.42
161 0.45
162 0.44
163 0.49
164 0.51
165 0.51
166 0.48
167 0.44
168 0.41
169 0.35
170 0.34
171 0.27
172 0.27
173 0.23
174 0.27
175 0.3
176 0.32
177 0.35
178 0.36
179 0.36
180 0.32
181 0.31
182 0.33
183 0.3
184 0.33
185 0.35
186 0.37
187 0.38
188 0.39
189 0.42
190 0.41
191 0.4
192 0.42
193 0.38
194 0.37
195 0.39
196 0.38
197 0.32
198 0.31
199 0.37
200 0.38
201 0.46
202 0.49
203 0.48
204 0.57
205 0.63
206 0.68
207 0.72
208 0.72
209 0.71
210 0.75
211 0.8
212 0.77
213 0.76
214 0.66
215 0.61
216 0.6