Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HSE4

Protein Details
Accession A0A2P5HSE4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-127PEDASRKLDKTKKRQQHFPQRKYAIKASHydrophilic
NLS Segment(s)
PositionSequence
89-115KQTRAIRRRLSPEDASRKLDKTKKRQQ
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSQSSAKIKAGQLWSKNKDELTKTLGELKTELGQLRIQKIASSGTKLNKIHDLRKSIARVLTIINAKERHHLRLFYKNKKYLPLDLRAKQTRAIRRRLSPEDASRKLDKTKKRQQHFPQRKYAIKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.59
4 0.55
5 0.53
6 0.49
7 0.45
8 0.4
9 0.37
10 0.33
11 0.39
12 0.37
13 0.32
14 0.28
15 0.26
16 0.23
17 0.23
18 0.22
19 0.16
20 0.18
21 0.19
22 0.21
23 0.21
24 0.18
25 0.17
26 0.17
27 0.2
28 0.18
29 0.19
30 0.21
31 0.22
32 0.3
33 0.3
34 0.31
35 0.34
36 0.37
37 0.39
38 0.4
39 0.42
40 0.37
41 0.42
42 0.42
43 0.36
44 0.34
45 0.28
46 0.24
47 0.2
48 0.21
49 0.18
50 0.16
51 0.17
52 0.18
53 0.18
54 0.23
55 0.24
56 0.25
57 0.26
58 0.29
59 0.29
60 0.38
61 0.46
62 0.5
63 0.57
64 0.58
65 0.58
66 0.61
67 0.6
68 0.58
69 0.55
70 0.54
71 0.54
72 0.52
73 0.59
74 0.57
75 0.55
76 0.51
77 0.54
78 0.54
79 0.53
80 0.58
81 0.55
82 0.58
83 0.66
84 0.67
85 0.66
86 0.63
87 0.66
88 0.66
89 0.64
90 0.63
91 0.58
92 0.55
93 0.57
94 0.58
95 0.58
96 0.59
97 0.65
98 0.7
99 0.75
100 0.82
101 0.85
102 0.89
103 0.9
104 0.88
105 0.88
106 0.87
107 0.86
108 0.82