Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HRA4

Protein Details
Accession A0A2P5HRA4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-180KVDDKTKAPVKAKKKAKKIKLSFGDDDBasic
NLS Segment(s)
PositionSequence
124-127KKRK
158-173KTKAPVKAKKKAKKIK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSNKITGKNLHYDQSLPPFLARLKGQHAADPDSPDPILASRRRQAKPRSASQEAEDAPLIVDDDGNVLAHVEVAADGTITTNRQADAGDGGNEGSMETGGEKDGGKDAKGVAVGHKAAMIGASKKRKLGKVVGAEDDMQDKGSIGLQKQDGAAKVDDKTKAPVKAKKKAKKIKLSFGDDDGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.31
4 0.28
5 0.27
6 0.26
7 0.28
8 0.25
9 0.21
10 0.25
11 0.31
12 0.32
13 0.33
14 0.35
15 0.36
16 0.37
17 0.39
18 0.33
19 0.29
20 0.28
21 0.24
22 0.21
23 0.17
24 0.21
25 0.2
26 0.26
27 0.29
28 0.39
29 0.43
30 0.51
31 0.57
32 0.61
33 0.64
34 0.68
35 0.71
36 0.66
37 0.64
38 0.58
39 0.56
40 0.47
41 0.41
42 0.31
43 0.23
44 0.18
45 0.16
46 0.14
47 0.07
48 0.06
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.07
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.05
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.09
96 0.1
97 0.1
98 0.09
99 0.12
100 0.12
101 0.11
102 0.11
103 0.1
104 0.08
105 0.09
106 0.09
107 0.1
108 0.16
109 0.23
110 0.24
111 0.28
112 0.33
113 0.36
114 0.39
115 0.43
116 0.45
117 0.47
118 0.5
119 0.48
120 0.45
121 0.42
122 0.37
123 0.32
124 0.24
125 0.16
126 0.12
127 0.09
128 0.08
129 0.11
130 0.13
131 0.11
132 0.16
133 0.17
134 0.18
135 0.19
136 0.22
137 0.2
138 0.21
139 0.22
140 0.19
141 0.21
142 0.25
143 0.26
144 0.25
145 0.3
146 0.33
147 0.39
148 0.45
149 0.52
150 0.56
151 0.63
152 0.73
153 0.76
154 0.81
155 0.84
156 0.86
157 0.89
158 0.88
159 0.89
160 0.88
161 0.87
162 0.79