Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5IDI4

Protein Details
Accession A0A2P5IDI4   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
282-302AGDHPKVPIKPKIKKSIRAKIBasic
NLS Segment(s)
PositionSequence
288-302VPIKPKIKKSIRAKI
Subcellular Location(s) cyto 16.5, cyto_nucl 11.5, nucl 5.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR041492  HAD_2  
IPR023214  HAD_sf  
IPR023198  PGP-like_dom2  
Gene Ontology GO:0016791  F:phosphatase activity  
Pfam View protein in Pfam  
PF13419  HAD_2  
CDD cd02603  HAD_sEH-N_like  
Amino Acid Sequences MLPEDQPVETILKGIDAEMGSQPKVILFDIGGVVVVSPFQSILDYELSLGIPPGWVNYSISKMSPNGFWHRLERGEIPLDTAFIDGFSKDLHRTELWEAFYKDQRAREPRLPDSTPPVPDLDAEFLFNDMMSSAVAPDPWVYPALKNLKASGKYILAALSNTIIFPPGHKLHRPDLASDPIRSMFDVFISSAHVGLRKPDPKIYELAVREVDKFARENRDSSRGKELGWSDGVKAADVLFLDDIGQNLKAASKAGFRTIKVNLGRAFEAVEELESITGLALAGDHPKVPIKPKIKKSIRAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.1
4 0.12
5 0.15
6 0.18
7 0.17
8 0.18
9 0.17
10 0.15
11 0.16
12 0.15
13 0.11
14 0.09
15 0.1
16 0.1
17 0.1
18 0.09
19 0.07
20 0.07
21 0.06
22 0.06
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.08
30 0.09
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.1
44 0.12
45 0.15
46 0.16
47 0.17
48 0.18
49 0.18
50 0.19
51 0.21
52 0.24
53 0.28
54 0.31
55 0.32
56 0.34
57 0.36
58 0.36
59 0.35
60 0.32
61 0.29
62 0.29
63 0.27
64 0.26
65 0.22
66 0.21
67 0.18
68 0.16
69 0.11
70 0.08
71 0.08
72 0.05
73 0.06
74 0.06
75 0.07
76 0.08
77 0.09
78 0.12
79 0.12
80 0.15
81 0.19
82 0.22
83 0.23
84 0.26
85 0.27
86 0.28
87 0.32
88 0.33
89 0.32
90 0.31
91 0.37
92 0.38
93 0.42
94 0.46
95 0.48
96 0.48
97 0.52
98 0.51
99 0.45
100 0.46
101 0.44
102 0.39
103 0.34
104 0.29
105 0.23
106 0.21
107 0.2
108 0.16
109 0.12
110 0.11
111 0.1
112 0.1
113 0.09
114 0.08
115 0.07
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.07
128 0.07
129 0.07
130 0.13
131 0.18
132 0.2
133 0.2
134 0.22
135 0.26
136 0.27
137 0.28
138 0.24
139 0.19
140 0.17
141 0.17
142 0.15
143 0.11
144 0.09
145 0.08
146 0.07
147 0.06
148 0.05
149 0.05
150 0.06
151 0.05
152 0.06
153 0.11
154 0.14
155 0.17
156 0.2
157 0.24
158 0.26
159 0.33
160 0.33
161 0.3
162 0.31
163 0.35
164 0.35
165 0.31
166 0.29
167 0.24
168 0.23
169 0.21
170 0.18
171 0.1
172 0.09
173 0.09
174 0.08
175 0.07
176 0.08
177 0.08
178 0.08
179 0.08
180 0.09
181 0.09
182 0.11
183 0.19
184 0.2
185 0.22
186 0.26
187 0.28
188 0.28
189 0.3
190 0.3
191 0.29
192 0.27
193 0.28
194 0.27
195 0.26
196 0.25
197 0.24
198 0.23
199 0.18
200 0.18
201 0.19
202 0.25
203 0.26
204 0.28
205 0.31
206 0.4
207 0.41
208 0.42
209 0.47
210 0.39
211 0.37
212 0.4
213 0.37
214 0.31
215 0.32
216 0.29
217 0.21
218 0.24
219 0.24
220 0.18
221 0.17
222 0.13
223 0.11
224 0.1
225 0.1
226 0.06
227 0.06
228 0.07
229 0.07
230 0.08
231 0.08
232 0.08
233 0.07
234 0.07
235 0.08
236 0.08
237 0.09
238 0.1
239 0.14
240 0.15
241 0.23
242 0.27
243 0.27
244 0.31
245 0.33
246 0.39
247 0.37
248 0.42
249 0.37
250 0.37
251 0.37
252 0.32
253 0.3
254 0.23
255 0.22
256 0.15
257 0.13
258 0.09
259 0.09
260 0.08
261 0.07
262 0.07
263 0.05
264 0.05
265 0.04
266 0.04
267 0.04
268 0.05
269 0.08
270 0.08
271 0.09
272 0.1
273 0.15
274 0.18
275 0.25
276 0.33
277 0.41
278 0.5
279 0.6
280 0.7
281 0.75
282 0.82