Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2B063

Protein Details
Accession H2B063   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-51ILLAAPKKKTSHKKKRQRFLSNANNNVEHydrophilic
NLS Segment(s)
PositionSequence
29-40PKKKTSHKKKRQ
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 3.5, plas 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG kaf:KAFR_0I02340  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSLAVRSSVIEVVRSVLVLKNWGILLAAPKKKTSHKKKRQRFLSNANNNVEFKNNLNRCPSCGHYKRSNTLCMFCVNQVRFLWKNHNKPEEIVKEVDRVVYPGKKDTQFIKKLKDKDSYLKKRMRTLPID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.13
6 0.13
7 0.13
8 0.13
9 0.13
10 0.12
11 0.1
12 0.16
13 0.23
14 0.28
15 0.27
16 0.3
17 0.33
18 0.42
19 0.52
20 0.57
21 0.6
22 0.66
23 0.76
24 0.84
25 0.91
26 0.93
27 0.92
28 0.89
29 0.88
30 0.88
31 0.86
32 0.83
33 0.75
34 0.67
35 0.57
36 0.49
37 0.4
38 0.3
39 0.23
40 0.26
41 0.25
42 0.25
43 0.3
44 0.3
45 0.3
46 0.32
47 0.33
48 0.33
49 0.36
50 0.39
51 0.42
52 0.45
53 0.5
54 0.5
55 0.54
56 0.45
57 0.42
58 0.38
59 0.31
60 0.29
61 0.24
62 0.28
63 0.21
64 0.23
65 0.21
66 0.26
67 0.26
68 0.27
69 0.36
70 0.38
71 0.46
72 0.51
73 0.56
74 0.51
75 0.51
76 0.58
77 0.52
78 0.47
79 0.41
80 0.34
81 0.31
82 0.3
83 0.3
84 0.21
85 0.18
86 0.19
87 0.2
88 0.2
89 0.23
90 0.29
91 0.29
92 0.32
93 0.38
94 0.44
95 0.49
96 0.53
97 0.58
98 0.6
99 0.65
100 0.69
101 0.7
102 0.65
103 0.67
104 0.73
105 0.73
106 0.75
107 0.75
108 0.74
109 0.75
110 0.78