Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5I1S5

Protein Details
Accession A0A2P5I1S5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPATGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13, cyto_nucl 10.333, mito_nucl 10.333, mito 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPATGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLVTVATLVDRLKVNGSLARQCLKDLEEKGQIKPIVTHSKMKIYTRAVGASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.9
4 0.93
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.33
16 0.25
17 0.18
18 0.17
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.19
27 0.21
28 0.23
29 0.27
30 0.28
31 0.25
32 0.24
33 0.22
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.11
47 0.13
48 0.15
49 0.18
50 0.21
51 0.2
52 0.2
53 0.2
54 0.2
55 0.23
56 0.22
57 0.25
58 0.31
59 0.32
60 0.33
61 0.38
62 0.38
63 0.32
64 0.33
65 0.35
66 0.36
67 0.37
68 0.44
69 0.4
70 0.48
71 0.52
72 0.53
73 0.53
74 0.48
75 0.5
76 0.46