Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HVD9

Protein Details
Accession A0A2P5HVD9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
314-341TPPWKLGGRKARFRSRRARRESEIKKIABasic
NLS Segment(s)
PositionSequence
151-155RRRKL
162-164RKA
318-385KLGGRKARFRSRRARRESEIKKIASDRELVKAEREKERIAEEAKRQRMLAKQRAKGQGRAQKEAAKEG
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRLGQLQRPIQAVAVAGSCRPTLATFALPCRPAIQSTPAQAHDGVVEGRRYASVKSQGAYRIPNKKTIAKKLGAKKSGDQHVIPGNIIFKQRGTMWHPGENAIKGRDHTIHAAVEGYVKYYRDPKLHPTRQYIGVAFNRDDTLPYPKDAPRRRKLGMVATTRKAHEKKDAISASGIPRRVVRKAGIFDIEELEQRLWSREKARELEAARKAAAALAADRASGATAAAAQAAAAAGETEATPITGGEKGQAEAGAAKSGKRTRSQQRRLVHPLTFIQKRWLERRRTRTLHLNPRSYSYTETNAAIGRLASRTMYTPPWKLGGRKARFRSRRARRESEIKKIASDRELVKAEREKERIAEEAKRQRMLAKQRAKGQGRAQKEAAKEGAKEGENGGENGGENGGEKAAEIGGEKMAETKVVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.14
4 0.15
5 0.14
6 0.13
7 0.13
8 0.12
9 0.13
10 0.15
11 0.2
12 0.21
13 0.27
14 0.33
15 0.33
16 0.32
17 0.32
18 0.31
19 0.27
20 0.28
21 0.29
22 0.28
23 0.33
24 0.38
25 0.37
26 0.38
27 0.35
28 0.32
29 0.26
30 0.22
31 0.19
32 0.16
33 0.16
34 0.14
35 0.14
36 0.16
37 0.16
38 0.16
39 0.22
40 0.27
41 0.29
42 0.3
43 0.33
44 0.37
45 0.4
46 0.46
47 0.47
48 0.48
49 0.48
50 0.55
51 0.55
52 0.58
53 0.63
54 0.66
55 0.66
56 0.63
57 0.69
58 0.72
59 0.77
60 0.75
61 0.7
62 0.65
63 0.65
64 0.67
65 0.62
66 0.52
67 0.47
68 0.47
69 0.44
70 0.38
71 0.31
72 0.24
73 0.23
74 0.25
75 0.21
76 0.15
77 0.16
78 0.17
79 0.21
80 0.25
81 0.31
82 0.33
83 0.37
84 0.38
85 0.39
86 0.41
87 0.38
88 0.36
89 0.29
90 0.27
91 0.23
92 0.26
93 0.24
94 0.24
95 0.23
96 0.23
97 0.21
98 0.19
99 0.19
100 0.16
101 0.16
102 0.13
103 0.13
104 0.12
105 0.12
106 0.13
107 0.18
108 0.22
109 0.24
110 0.27
111 0.35
112 0.45
113 0.53
114 0.58
115 0.59
116 0.59
117 0.59
118 0.59
119 0.5
120 0.45
121 0.41
122 0.38
123 0.32
124 0.28
125 0.24
126 0.21
127 0.21
128 0.16
129 0.2
130 0.18
131 0.18
132 0.21
133 0.24
134 0.34
135 0.42
136 0.5
137 0.51
138 0.56
139 0.57
140 0.58
141 0.58
142 0.58
143 0.57
144 0.56
145 0.55
146 0.52
147 0.53
148 0.49
149 0.52
150 0.46
151 0.4
152 0.39
153 0.37
154 0.35
155 0.41
156 0.41
157 0.35
158 0.34
159 0.34
160 0.31
161 0.3
162 0.29
163 0.2
164 0.23
165 0.24
166 0.25
167 0.25
168 0.22
169 0.24
170 0.25
171 0.27
172 0.25
173 0.23
174 0.22
175 0.21
176 0.19
177 0.14
178 0.13
179 0.1
180 0.09
181 0.08
182 0.1
183 0.1
184 0.12
185 0.16
186 0.19
187 0.24
188 0.26
189 0.28
190 0.32
191 0.32
192 0.38
193 0.37
194 0.34
195 0.29
196 0.26
197 0.24
198 0.18
199 0.17
200 0.09
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.05
208 0.05
209 0.04
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.02
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.04
230 0.05
231 0.05
232 0.06
233 0.07
234 0.08
235 0.08
236 0.08
237 0.07
238 0.08
239 0.08
240 0.09
241 0.09
242 0.09
243 0.14
244 0.18
245 0.21
246 0.24
247 0.32
248 0.4
249 0.51
250 0.6
251 0.64
252 0.66
253 0.72
254 0.76
255 0.73
256 0.64
257 0.55
258 0.51
259 0.5
260 0.47
261 0.39
262 0.38
263 0.37
264 0.4
265 0.46
266 0.5
267 0.53
268 0.59
269 0.67
270 0.71
271 0.71
272 0.72
273 0.73
274 0.75
275 0.76
276 0.75
277 0.73
278 0.63
279 0.63
280 0.62
281 0.52
282 0.46
283 0.38
284 0.34
285 0.29
286 0.28
287 0.25
288 0.22
289 0.21
290 0.16
291 0.13
292 0.11
293 0.09
294 0.09
295 0.08
296 0.08
297 0.1
298 0.12
299 0.18
300 0.22
301 0.24
302 0.25
303 0.3
304 0.32
305 0.34
306 0.4
307 0.45
308 0.48
309 0.56
310 0.63
311 0.69
312 0.73
313 0.79
314 0.8
315 0.81
316 0.84
317 0.83
318 0.83
319 0.79
320 0.83
321 0.82
322 0.82
323 0.79
324 0.69
325 0.64
326 0.6
327 0.56
328 0.48
329 0.46
330 0.37
331 0.35
332 0.38
333 0.34
334 0.37
335 0.4
336 0.42
337 0.45
338 0.46
339 0.41
340 0.4
341 0.42
342 0.41
343 0.38
344 0.4
345 0.42
346 0.49
347 0.53
348 0.52
349 0.5
350 0.5
351 0.54
352 0.57
353 0.58
354 0.57
355 0.58
356 0.65
357 0.75
358 0.75
359 0.74
360 0.73
361 0.71
362 0.68
363 0.68
364 0.63
365 0.59
366 0.56
367 0.55
368 0.5
369 0.45
370 0.39
371 0.36
372 0.39
373 0.34
374 0.33
375 0.28
376 0.28
377 0.26
378 0.25
379 0.22
380 0.17
381 0.16
382 0.16
383 0.15
384 0.09
385 0.08
386 0.09
387 0.08
388 0.07
389 0.07
390 0.07
391 0.07
392 0.07
393 0.08
394 0.08
395 0.09
396 0.1
397 0.1
398 0.11
399 0.11