Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5I5Z0

Protein Details
Accession A0A2P5I5Z0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
76-106VDEPSKTKPKAKGKIVKRRGRKSNIVFPKFGHydrophilic
NLS Segment(s)
PositionSequence
81-113KTKPKAKGKIVKRRGRKSNIVFPKFGERRNKKR
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSQRSSVTKANNQRLKKNVFGPVEAARQQRLSARLLEIASQPRPVPEKDMKDAAEQGITKAVDKSKQAGTAMEVDEPSKTKPKAKGKIVKRRGRKSNIVFPKFGERRNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.74
4 0.7
5 0.67
6 0.63
7 0.61
8 0.55
9 0.51
10 0.47
11 0.43
12 0.42
13 0.41
14 0.37
15 0.3
16 0.28
17 0.27
18 0.28
19 0.26
20 0.22
21 0.2
22 0.19
23 0.2
24 0.2
25 0.2
26 0.19
27 0.21
28 0.2
29 0.19
30 0.18
31 0.17
32 0.2
33 0.19
34 0.22
35 0.24
36 0.28
37 0.29
38 0.33
39 0.32
40 0.31
41 0.31
42 0.25
43 0.21
44 0.16
45 0.13
46 0.13
47 0.12
48 0.11
49 0.12
50 0.13
51 0.13
52 0.14
53 0.17
54 0.16
55 0.18
56 0.18
57 0.17
58 0.18
59 0.19
60 0.19
61 0.16
62 0.14
63 0.12
64 0.13
65 0.13
66 0.14
67 0.18
68 0.19
69 0.24
70 0.33
71 0.44
72 0.52
73 0.61
74 0.69
75 0.72
76 0.82
77 0.87
78 0.87
79 0.87
80 0.88
81 0.88
82 0.87
83 0.87
84 0.84
85 0.84
86 0.86
87 0.8
88 0.71
89 0.64
90 0.67
91 0.61
92 0.6
93 0.6