Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HFV8

Protein Details
Accession A0A2P5HFV8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MGLWRRMRNKLKNRSSKKSARPMRYARAHydrophilic
NLS Segment(s)
PositionSequence
6-23RMRNKLKNRSSKKSARPM
Subcellular Location(s) nucl 12, mito_nucl 11.333, mito 9.5, cyto_nucl 9.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGLWRRMRNKLKNRSSKKSARPMRYARAGHENPFDDVPRVSTTSSPPRTPPKQALFDEDTMSLFRPSMISYYSRIFGFAGVVPSYVASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.87
5 0.87
6 0.86
7 0.83
8 0.83
9 0.8
10 0.79
11 0.78
12 0.7
13 0.63
14 0.63
15 0.57
16 0.51
17 0.48
18 0.42
19 0.34
20 0.34
21 0.3
22 0.21
23 0.19
24 0.17
25 0.14
26 0.13
27 0.12
28 0.12
29 0.16
30 0.24
31 0.27
32 0.26
33 0.28
34 0.35
35 0.38
36 0.42
37 0.46
38 0.43
39 0.47
40 0.47
41 0.5
42 0.46
43 0.43
44 0.4
45 0.32
46 0.27
47 0.2
48 0.2
49 0.14
50 0.1
51 0.08
52 0.08
53 0.08
54 0.09
55 0.1
56 0.1
57 0.13
58 0.16
59 0.18
60 0.17
61 0.18
62 0.16
63 0.15
64 0.15
65 0.14
66 0.15
67 0.13
68 0.13
69 0.12