Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2ASM1

Protein Details
Accession H2ASM1    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-44SLHFRSCKPKKFSTMKKTKFHKKSSNNFDNKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 7.499, plas 7, nucl 6.5, cyto_nucl 6.333
Family & Domain DBs
KEGG kaf:KAFR_0C03800  -  
Amino Acid Sequences MYKSIQFCRSISSLHFRSCKPKKFSTMKKTKFHKKSSNNFDNKSVADKSSIRGKQVALIGVLAILTTAVSFTYQKNKPIEFIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.38
4 0.48
5 0.55
6 0.61
7 0.58
8 0.61
9 0.64
10 0.71
11 0.79
12 0.8
13 0.82
14 0.81
15 0.84
16 0.86
17 0.87
18 0.86
19 0.84
20 0.83
21 0.82
22 0.83
23 0.85
24 0.86
25 0.81
26 0.74
27 0.68
28 0.6
29 0.5
30 0.44
31 0.34
32 0.24
33 0.21
34 0.19
35 0.18
36 0.26
37 0.27
38 0.24
39 0.25
40 0.24
41 0.25
42 0.27
43 0.26
44 0.16
45 0.15
46 0.13
47 0.11
48 0.11
49 0.07
50 0.04
51 0.03
52 0.02
53 0.02
54 0.02
55 0.03
56 0.04
57 0.06
58 0.09
59 0.18
60 0.22
61 0.29
62 0.35
63 0.36