Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HYM9

Protein Details
Accession A0A2P5HYM9   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-110ASALQQQKTRRRRGSLRKVALLHydrophilic
NLS Segment(s)
PositionSequence
97-119TRRRRGSLRKVALLGRGAQRERR
Subcellular Location(s) plas 21, nucl 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029164  PIG-Y  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15159  PIG-Y  
Amino Acid Sequences MEPLPSTQDTHQGGPGATDPSRPVHRRKSSGGGLLSKLSFMRAHSSSSSASEQHEHDGTAQLRDKETRSPPDDSSNIYMPAPRPSSSIASALQQQKTRRRRGSLRKVALLGRGAQRERREAHRASLSIDVKQAETYSMSIPKEEGGAFGLGISDITPRPSMDGYASRNTPAVEATNNLLRDGAAPGAAAAAAAAAALPKPKVEIDEPTPTSPTMSYTTTDDEDMLHIGRNAGSRKVPELASLSSGSDGYFGSLPRRRTISRARSPLSLSGLASTPILPTDDDWDYTETEWWGWVILIVTWVVFVIGMGSCFSVWSWAWDVGTTPYAPPELEDDPTLPITGYYPALIILTCVMAWVWVVSAWVGMKYFRHAKISGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.24
4 0.21
5 0.21
6 0.21
7 0.24
8 0.34
9 0.37
10 0.44
11 0.5
12 0.59
13 0.64
14 0.68
15 0.71
16 0.68
17 0.7
18 0.68
19 0.61
20 0.54
21 0.51
22 0.45
23 0.37
24 0.3
25 0.25
26 0.2
27 0.17
28 0.22
29 0.19
30 0.23
31 0.23
32 0.26
33 0.25
34 0.27
35 0.29
36 0.24
37 0.25
38 0.25
39 0.25
40 0.26
41 0.25
42 0.22
43 0.2
44 0.26
45 0.24
46 0.27
47 0.3
48 0.28
49 0.29
50 0.32
51 0.33
52 0.34
53 0.4
54 0.43
55 0.43
56 0.45
57 0.46
58 0.5
59 0.5
60 0.46
61 0.43
62 0.37
63 0.34
64 0.3
65 0.3
66 0.24
67 0.29
68 0.28
69 0.24
70 0.23
71 0.24
72 0.28
73 0.27
74 0.28
75 0.22
76 0.21
77 0.28
78 0.33
79 0.34
80 0.35
81 0.4
82 0.47
83 0.56
84 0.64
85 0.64
86 0.66
87 0.72
88 0.79
89 0.83
90 0.84
91 0.82
92 0.76
93 0.72
94 0.66
95 0.59
96 0.5
97 0.42
98 0.37
99 0.35
100 0.32
101 0.34
102 0.34
103 0.36
104 0.38
105 0.4
106 0.42
107 0.38
108 0.42
109 0.43
110 0.4
111 0.37
112 0.42
113 0.36
114 0.31
115 0.31
116 0.26
117 0.21
118 0.2
119 0.18
120 0.11
121 0.1
122 0.1
123 0.1
124 0.14
125 0.14
126 0.14
127 0.14
128 0.13
129 0.14
130 0.12
131 0.1
132 0.08
133 0.08
134 0.07
135 0.07
136 0.06
137 0.05
138 0.05
139 0.04
140 0.04
141 0.05
142 0.06
143 0.07
144 0.06
145 0.08
146 0.08
147 0.09
148 0.1
149 0.14
150 0.17
151 0.2
152 0.2
153 0.2
154 0.2
155 0.2
156 0.18
157 0.14
158 0.11
159 0.08
160 0.09
161 0.1
162 0.12
163 0.12
164 0.12
165 0.11
166 0.1
167 0.1
168 0.1
169 0.09
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.03
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.07
189 0.08
190 0.12
191 0.16
192 0.23
193 0.25
194 0.25
195 0.26
196 0.24
197 0.24
198 0.2
199 0.18
200 0.13
201 0.12
202 0.13
203 0.13
204 0.16
205 0.16
206 0.16
207 0.14
208 0.11
209 0.11
210 0.1
211 0.09
212 0.07
213 0.07
214 0.07
215 0.08
216 0.11
217 0.12
218 0.13
219 0.15
220 0.15
221 0.17
222 0.19
223 0.18
224 0.17
225 0.18
226 0.17
227 0.17
228 0.17
229 0.15
230 0.13
231 0.13
232 0.11
233 0.09
234 0.08
235 0.07
236 0.07
237 0.07
238 0.14
239 0.18
240 0.2
241 0.22
242 0.27
243 0.27
244 0.33
245 0.43
246 0.47
247 0.52
248 0.59
249 0.59
250 0.57
251 0.59
252 0.56
253 0.49
254 0.4
255 0.31
256 0.24
257 0.21
258 0.19
259 0.17
260 0.13
261 0.09
262 0.08
263 0.08
264 0.07
265 0.07
266 0.11
267 0.12
268 0.13
269 0.14
270 0.16
271 0.16
272 0.16
273 0.17
274 0.13
275 0.12
276 0.11
277 0.09
278 0.08
279 0.07
280 0.07
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.04
289 0.04
290 0.03
291 0.04
292 0.04
293 0.05
294 0.05
295 0.06
296 0.06
297 0.06
298 0.06
299 0.08
300 0.08
301 0.11
302 0.14
303 0.15
304 0.15
305 0.15
306 0.17
307 0.16
308 0.18
309 0.16
310 0.13
311 0.13
312 0.14
313 0.13
314 0.13
315 0.15
316 0.16
317 0.17
318 0.18
319 0.17
320 0.19
321 0.2
322 0.19
323 0.14
324 0.12
325 0.12
326 0.12
327 0.12
328 0.1
329 0.09
330 0.09
331 0.1
332 0.09
333 0.08
334 0.07
335 0.07
336 0.06
337 0.06
338 0.06
339 0.06
340 0.06
341 0.06
342 0.05
343 0.05
344 0.06
345 0.05
346 0.07
347 0.08
348 0.09
349 0.1
350 0.11
351 0.12
352 0.19
353 0.27
354 0.29
355 0.34