Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AVS2

Protein Details
Accession H2AVS2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22TSSKLRRSTKREYYWFSRHFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013717  PIG-P  
Gene Ontology GO:0016020  C:membrane  
KEGG kaf:KAFR_0E03200  -  
Pfam View protein in Pfam  
PF08510  PIG-P  
Amino Acid Sequences METSSKLRRSTKREYYWFSRHFIVTSLLIFILIWSFVGGYDNKILPNRNWVLILQCIVLMGMLFAYFGLIFYNDDILAPNLDDMRTITDSHACIVTTDKDDLVKNFAFKETSGVIDLPIMDVCDVLYRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.8
4 0.76
5 0.69
6 0.62
7 0.53
8 0.45
9 0.39
10 0.33
11 0.24
12 0.2
13 0.18
14 0.13
15 0.12
16 0.11
17 0.09
18 0.07
19 0.05
20 0.04
21 0.03
22 0.04
23 0.04
24 0.06
25 0.06
26 0.07
27 0.1
28 0.1
29 0.12
30 0.14
31 0.16
32 0.15
33 0.23
34 0.23
35 0.21
36 0.22
37 0.2
38 0.2
39 0.19
40 0.19
41 0.11
42 0.1
43 0.09
44 0.07
45 0.07
46 0.05
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.06
64 0.05
65 0.05
66 0.06
67 0.05
68 0.05
69 0.06
70 0.05
71 0.09
72 0.1
73 0.1
74 0.11
75 0.13
76 0.14
77 0.15
78 0.15
79 0.11
80 0.11
81 0.12
82 0.14
83 0.14
84 0.14
85 0.14
86 0.16
87 0.17
88 0.18
89 0.21
90 0.2
91 0.18
92 0.19
93 0.2
94 0.19
95 0.17
96 0.2
97 0.17
98 0.17
99 0.17
100 0.16
101 0.15
102 0.15
103 0.15
104 0.11
105 0.1
106 0.09
107 0.07
108 0.07
109 0.07
110 0.1