Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5ID19

Protein Details
Accession A0A2P5ID19    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
86-107CPKPDLLKLKLKMRKKKESKSQBasic
NLS Segment(s)
PositionSequence
93-106KLKLKMRKKKESKS
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR027179  MTCP1  
Pfam View protein in Pfam  
PF08991  MTCP1  
Amino Acid Sequences MVRKHRASVLFYCHVTNDGAVCRDWKKICRRSLHAIPEHIRLRLVADCLKRNTYKEDRCQGVIDALYDCCQAFYDRNGEGASAASCPKPDLLKLKLKMRKKKESKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.23
4 0.17
5 0.15
6 0.15
7 0.14
8 0.17
9 0.17
10 0.23
11 0.26
12 0.31
13 0.39
14 0.46
15 0.53
16 0.58
17 0.63
18 0.66
19 0.71
20 0.72
21 0.67
22 0.65
23 0.6
24 0.6
25 0.55
26 0.46
27 0.37
28 0.28
29 0.25
30 0.2
31 0.2
32 0.17
33 0.18
34 0.22
35 0.24
36 0.27
37 0.27
38 0.27
39 0.32
40 0.36
41 0.39
42 0.42
43 0.47
44 0.45
45 0.45
46 0.44
47 0.38
48 0.31
49 0.25
50 0.18
51 0.13
52 0.11
53 0.1
54 0.09
55 0.09
56 0.07
57 0.07
58 0.08
59 0.08
60 0.11
61 0.14
62 0.14
63 0.15
64 0.15
65 0.15
66 0.14
67 0.13
68 0.11
69 0.09
70 0.1
71 0.09
72 0.09
73 0.1
74 0.12
75 0.13
76 0.17
77 0.23
78 0.28
79 0.37
80 0.43
81 0.53
82 0.59
83 0.67
84 0.74
85 0.77
86 0.81
87 0.82