Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HSL2

Protein Details
Accession A0A2P5HSL2   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-30NCISRNRQRALRSKARKHTLQHydrophilic
NLS Segment(s)
PositionSequence
19-27ALRSKARKH
38-84PDRVAKADTKRGARTGLLPTSGPNKPLSSKKARKLEKQMAHAIRRKR
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences MPSASVKNPNCISRNRQRALRSKARKHTLQAAASARLPDRVAKADTKRGARTGLLPTSGPNKPLSSKKARKLEKQMAHAIRRKREEEERQSQVEMKDAEEKSSKKQLKTERNAAVEALEKMEIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.65
4 0.67
5 0.73
6 0.76
7 0.78
8 0.78
9 0.77
10 0.82
11 0.83
12 0.8
13 0.74
14 0.74
15 0.71
16 0.63
17 0.59
18 0.52
19 0.46
20 0.42
21 0.39
22 0.29
23 0.23
24 0.22
25 0.17
26 0.16
27 0.17
28 0.18
29 0.23
30 0.26
31 0.32
32 0.37
33 0.39
34 0.38
35 0.37
36 0.36
37 0.31
38 0.31
39 0.28
40 0.24
41 0.21
42 0.19
43 0.18
44 0.22
45 0.22
46 0.19
47 0.16
48 0.15
49 0.17
50 0.22
51 0.28
52 0.33
53 0.4
54 0.47
55 0.56
56 0.61
57 0.65
58 0.7
59 0.74
60 0.7
61 0.68
62 0.68
63 0.66
64 0.67
65 0.65
66 0.62
67 0.59
68 0.57
69 0.54
70 0.51
71 0.53
72 0.57
73 0.6
74 0.63
75 0.61
76 0.57
77 0.56
78 0.54
79 0.45
80 0.4
81 0.31
82 0.24
83 0.27
84 0.25
85 0.27
86 0.3
87 0.31
88 0.32
89 0.42
90 0.46
91 0.41
92 0.48
93 0.56
94 0.61
95 0.69
96 0.72
97 0.7
98 0.68
99 0.66
100 0.58
101 0.5
102 0.42
103 0.34
104 0.26