Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5ID07

Protein Details
Accession A0A2P5ID07    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRQPQGKKRGDPLPTBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRQPQGKKR
Subcellular Location(s) mito 14, cyto 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRQPQGKKRGDPLPTVFTCLFCNHENSVTVKIDKKAGIGSLECKVCGQRFQCTVNYLSAAVDVYGEWVDAAEEVAKDGGSAAVRDYAQASRDTRKDRDTANNSDDGHQYSGDGIVPDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.85
3 0.82
4 0.75
5 0.71
6 0.65
7 0.63
8 0.54
9 0.52
10 0.45
11 0.38
12 0.36
13 0.3
14 0.28
15 0.21
16 0.24
17 0.2
18 0.22
19 0.22
20 0.22
21 0.25
22 0.24
23 0.25
24 0.24
25 0.24
26 0.25
27 0.23
28 0.22
29 0.19
30 0.18
31 0.17
32 0.15
33 0.16
34 0.17
35 0.17
36 0.16
37 0.15
38 0.16
39 0.15
40 0.19
41 0.18
42 0.18
43 0.21
44 0.24
45 0.26
46 0.26
47 0.27
48 0.23
49 0.22
50 0.17
51 0.13
52 0.11
53 0.09
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.08
77 0.08
78 0.09
79 0.1
80 0.1
81 0.12
82 0.15
83 0.18
84 0.22
85 0.28
86 0.33
87 0.36
88 0.38
89 0.4
90 0.42
91 0.5
92 0.51
93 0.52
94 0.51
95 0.52
96 0.5
97 0.49
98 0.46
99 0.38
100 0.33
101 0.25
102 0.22
103 0.17
104 0.16
105 0.14
106 0.13
107 0.1