Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2B2A7

Protein Details
Accession H2B2A7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-104GMFTDSVLRKRRKKMKKHKLRKRRKRERADKRKLSQGKBasic
NLS Segment(s)
PositionSequence
75-104RKRRKKMKKHKLRKRRKRERADKRKLSQGK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG kaf:KAFR_0L01475  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MMFRQLTRLMVPRTVLIRPSVLCSMNRGYHATSGVINDSISFIPWIPWKKPTSLLQAVGAASVQEDGMFTDSVLRKRRKKMKKHKLRKRRKRERADKRKLSQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.23
4 0.23
5 0.21
6 0.24
7 0.24
8 0.23
9 0.22
10 0.24
11 0.27
12 0.27
13 0.28
14 0.26
15 0.24
16 0.23
17 0.24
18 0.21
19 0.16
20 0.15
21 0.14
22 0.12
23 0.11
24 0.09
25 0.09
26 0.08
27 0.08
28 0.07
29 0.06
30 0.07
31 0.12
32 0.15
33 0.15
34 0.2
35 0.21
36 0.23
37 0.27
38 0.3
39 0.34
40 0.34
41 0.33
42 0.29
43 0.29
44 0.27
45 0.22
46 0.18
47 0.1
48 0.07
49 0.05
50 0.04
51 0.03
52 0.03
53 0.03
54 0.05
55 0.05
56 0.05
57 0.11
58 0.14
59 0.2
60 0.28
61 0.36
62 0.41
63 0.52
64 0.62
65 0.67
66 0.75
67 0.82
68 0.85
69 0.89
70 0.93
71 0.94
72 0.95
73 0.97
74 0.97
75 0.97
76 0.97
77 0.96
78 0.96
79 0.96
80 0.97
81 0.97
82 0.97
83 0.96
84 0.91