Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HHI8

Protein Details
Accession A0A2P5HHI8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
117-143VTFPRPQPPPSPRPRPRPGPVRPPPGNHydrophilic
NLS Segment(s)
PositionSequence
61-152KFPRPQPPPSPRPHPRPGPVRPPPGVPTPPPTPRRPAKGVSMAVGGGGKLGREPGLVTFPRPQPPPSPRPRPRPGPVRPPPGNPTPPPTPRR
Subcellular Location(s) mito 15, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MGMHSNTFMVPSTTQKNFPAAHGLEAKISIHAAQRPSGKDSVNADALGILVLIGGKPAIIKFPRPQPPPSPRPHPRPGPVRPPPGVPTPPPTPRRPAKGVSMAVGGGGKLGREPGLVTFPRPQPPPSPRPRPRPGPVRPPPGNPTPPPTPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.34
4 0.33
5 0.33
6 0.36
7 0.3
8 0.31
9 0.31
10 0.3
11 0.25
12 0.25
13 0.24
14 0.16
15 0.16
16 0.13
17 0.13
18 0.15
19 0.16
20 0.2
21 0.24
22 0.26
23 0.3
24 0.31
25 0.29
26 0.29
27 0.31
28 0.31
29 0.28
30 0.25
31 0.21
32 0.18
33 0.17
34 0.13
35 0.09
36 0.05
37 0.03
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.03
45 0.07
46 0.08
47 0.12
48 0.16
49 0.25
50 0.34
51 0.37
52 0.41
53 0.46
54 0.54
55 0.58
56 0.61
57 0.62
58 0.61
59 0.65
60 0.68
61 0.66
62 0.64
63 0.65
64 0.64
65 0.65
66 0.65
67 0.63
68 0.57
69 0.53
70 0.49
71 0.46
72 0.42
73 0.34
74 0.32
75 0.32
76 0.39
77 0.41
78 0.41
79 0.43
80 0.46
81 0.51
82 0.5
83 0.47
84 0.46
85 0.48
86 0.47
87 0.41
88 0.36
89 0.29
90 0.25
91 0.22
92 0.15
93 0.08
94 0.07
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.07
102 0.13
103 0.14
104 0.17
105 0.23
106 0.27
107 0.33
108 0.35
109 0.36
110 0.38
111 0.47
112 0.54
113 0.58
114 0.65
115 0.68
116 0.76
117 0.82
118 0.83
119 0.83
120 0.84
121 0.83
122 0.83
123 0.84
124 0.84
125 0.8
126 0.77
127 0.74
128 0.73
129 0.72
130 0.64
131 0.62
132 0.61