Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2B1J8

Protein Details
Accession H2B1J8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-62HKRRSDPQFRRELKNRVKKQRQQEKLNKEAEQBasic
NLS Segment(s)
PositionSequence
41-50RELKNRVKKQ
Subcellular Location(s) nucl 16, cyto_nucl 11.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
KEGG kaf:KAFR_0K01440  -  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MSESRGLVRALGMTAAVAVASFTGYALYFDHKRRSDPQFRRELKNRVKKQRQQEKLNKEAEQKLKVQKVTDFLTEELVKDPVSTDPSQRETVFTSNIEQGERLSMIPGNEMEAAAKFYKALTVYPNPADLLGIYQRSVPDNVYEFIVLMIAVLPPTNVSSFLNGGASKNEPPIISEIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.06
14 0.11
15 0.16
16 0.2
17 0.29
18 0.3
19 0.34
20 0.41
21 0.5
22 0.56
23 0.6
24 0.65
25 0.68
26 0.71
27 0.77
28 0.78
29 0.79
30 0.79
31 0.8
32 0.81
33 0.82
34 0.87
35 0.86
36 0.88
37 0.88
38 0.87
39 0.87
40 0.87
41 0.85
42 0.83
43 0.81
44 0.73
45 0.68
46 0.66
47 0.61
48 0.54
49 0.5
50 0.49
51 0.48
52 0.46
53 0.42
54 0.36
55 0.35
56 0.34
57 0.3
58 0.25
59 0.2
60 0.22
61 0.2
62 0.19
63 0.16
64 0.14
65 0.11
66 0.09
67 0.1
68 0.08
69 0.11
70 0.11
71 0.12
72 0.15
73 0.18
74 0.21
75 0.2
76 0.2
77 0.18
78 0.19
79 0.19
80 0.16
81 0.15
82 0.15
83 0.15
84 0.14
85 0.12
86 0.11
87 0.1
88 0.1
89 0.08
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.07
99 0.06
100 0.09
101 0.08
102 0.08
103 0.07
104 0.06
105 0.08
106 0.09
107 0.09
108 0.12
109 0.15
110 0.19
111 0.2
112 0.21
113 0.19
114 0.19
115 0.18
116 0.13
117 0.12
118 0.11
119 0.11
120 0.11
121 0.12
122 0.12
123 0.14
124 0.15
125 0.13
126 0.13
127 0.15
128 0.16
129 0.16
130 0.15
131 0.13
132 0.12
133 0.12
134 0.08
135 0.06
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.06
143 0.07
144 0.08
145 0.09
146 0.11
147 0.12
148 0.14
149 0.16
150 0.15
151 0.16
152 0.17
153 0.2
154 0.19
155 0.21
156 0.22
157 0.19
158 0.21
159 0.24