Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5HU39

Protein Details
Accession A0A2P5HU39    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
61-85VVPFLGRSWHRRRKERRSATLPAAGHydrophilic
NLS Segment(s)
PositionSequence
71-77RRRKERR
Subcellular Location(s) extr 11, mito 7, cyto 5, nucl 1, plas 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPGITPAVHAPVSTSSSYGLAGRDSASDSDQPAGAPIKLPPASLLGIGAASAILLVLLIVVPFLGRSWHRRRKERRSATLPAAGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.14
4 0.14
5 0.15
6 0.14
7 0.12
8 0.09
9 0.09
10 0.09
11 0.09
12 0.1
13 0.1
14 0.11
15 0.11
16 0.11
17 0.11
18 0.11
19 0.1
20 0.1
21 0.11
22 0.09
23 0.09
24 0.08
25 0.13
26 0.13
27 0.13
28 0.12
29 0.12
30 0.13
31 0.12
32 0.12
33 0.06
34 0.06
35 0.06
36 0.05
37 0.03
38 0.02
39 0.02
40 0.02
41 0.02
42 0.01
43 0.01
44 0.01
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.06
53 0.08
54 0.17
55 0.28
56 0.38
57 0.47
58 0.58
59 0.69
60 0.77
61 0.86
62 0.89
63 0.89
64 0.87
65 0.86
66 0.83