Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5I7P2

Protein Details
Accession A0A2P5I7P2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-25IKNRVFPRRFGRRHGRYQHFLBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MRHFIKNRVFPRRFGRRHGRYQHFLEPTFEGLPPEIRLRIFEFGRGIEDLRAAVRASPARHRQYLDRDLDSGPPKKTEKERPVKLSWTFERHGLKERCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.7
4 0.78
5 0.82
6 0.81
7 0.76
8 0.77
9 0.76
10 0.7
11 0.63
12 0.54
13 0.45
14 0.39
15 0.34
16 0.28
17 0.19
18 0.15
19 0.15
20 0.14
21 0.14
22 0.13
23 0.12
24 0.13
25 0.15
26 0.18
27 0.17
28 0.17
29 0.16
30 0.15
31 0.17
32 0.15
33 0.13
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.08
42 0.1
43 0.12
44 0.19
45 0.27
46 0.31
47 0.34
48 0.35
49 0.38
50 0.44
51 0.5
52 0.48
53 0.41
54 0.39
55 0.37
56 0.41
57 0.41
58 0.38
59 0.31
60 0.31
61 0.32
62 0.36
63 0.43
64 0.49
65 0.54
66 0.6
67 0.67
68 0.7
69 0.73
70 0.74
71 0.71
72 0.69
73 0.66
74 0.62
75 0.54
76 0.54
77 0.56
78 0.51
79 0.56