Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HGC6

Protein Details
Accession A0A2P5HGC6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-116LERRAGRKDGWRRPRAWKGDBasic
NLS Segment(s)
PositionSequence
49-51RKR
99-113RRAGRKDGWRRPRAW
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007264  H/ACA_rnp_Nop10  
IPR036756  H/ACA_rnp_Nop10_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0030515  F:snoRNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04135  Nop10p  
Amino Acid Sequences MHLMCNVDPASGKRTYTLKKVLEGKVTKSAHPARFSPDDKWSKHRNLLRKRFGRLPQESGEIKKGIAKEPWPSLTVGENSVGMMARCSVRLSAPHALERRAGRKDGWRRPRAWKGDGSGIQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.38
4 0.44
5 0.42
6 0.46
7 0.54
8 0.55
9 0.57
10 0.55
11 0.52
12 0.53
13 0.51
14 0.45
15 0.46
16 0.5
17 0.46
18 0.46
19 0.43
20 0.4
21 0.46
22 0.48
23 0.43
24 0.44
25 0.46
26 0.45
27 0.51
28 0.52
29 0.5
30 0.55
31 0.58
32 0.58
33 0.62
34 0.7
35 0.73
36 0.71
37 0.7
38 0.7
39 0.71
40 0.7
41 0.64
42 0.58
43 0.49
44 0.48
45 0.45
46 0.39
47 0.34
48 0.25
49 0.21
50 0.19
51 0.18
52 0.15
53 0.16
54 0.16
55 0.18
56 0.21
57 0.22
58 0.21
59 0.2
60 0.19
61 0.2
62 0.19
63 0.16
64 0.13
65 0.11
66 0.1
67 0.1
68 0.1
69 0.07
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.08
76 0.09
77 0.11
78 0.16
79 0.22
80 0.23
81 0.3
82 0.31
83 0.32
84 0.36
85 0.39
86 0.41
87 0.39
88 0.39
89 0.35
90 0.43
91 0.53
92 0.58
93 0.64
94 0.65
95 0.66
96 0.74
97 0.81
98 0.78
99 0.74
100 0.69
101 0.64
102 0.67