Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5I3W3

Protein Details
Accession A0A2P5I3W3    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
40-60PDGPWRRKNTKIKHELIHKAKBasic
184-211EEAPLHRGPRQRRENRKRRPDYYDKALEBasic
NLS Segment(s)
PositionSequence
26-74AKKRKGFRVGPANLPDGPWRRKNTKIKHELIHKAKLKKDYAKVKAELAR
190-203RGPRQRRENRKRRP
216-272KKAEAEARAAEAERREKERARSIDERERTRRAILKAKGFSASGKPRGKPKLGRESKV
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MGSKRPHDEVEGEGGPTTTTAAAPEAKKRKGFRVGPANLPDGPWRRKNTKIKHELIHKAKLKKDYAKVKAELAREKEKEAQQGSSSSRPAWDAATATTGEPLFHPDRQLQMDDHHDDDDDRQHVNPERQAFLDGIVETAAPPPRSRQARAPDEPTPAENRQDGGAQQGEQGEGGPTTTTPSQSEEAPLHRGPRQRRENRKRRPDYYDKALEEGSLKKAEAEARAAEAERREKERARSIDERERTRRAILKAKGFSASGKPRGKPKLGRESKVLLDKVKRMVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.17
4 0.15
5 0.08
6 0.07
7 0.07
8 0.09
9 0.14
10 0.17
11 0.27
12 0.34
13 0.4
14 0.47
15 0.5
16 0.56
17 0.62
18 0.65
19 0.65
20 0.67
21 0.67
22 0.68
23 0.68
24 0.63
25 0.53
26 0.48
27 0.46
28 0.43
29 0.44
30 0.44
31 0.47
32 0.49
33 0.59
34 0.67
35 0.71
36 0.74
37 0.78
38 0.77
39 0.78
40 0.81
41 0.82
42 0.78
43 0.77
44 0.73
45 0.7
46 0.69
47 0.68
48 0.66
49 0.64
50 0.66
51 0.67
52 0.68
53 0.68
54 0.64
55 0.63
56 0.61
57 0.59
58 0.57
59 0.52
60 0.53
61 0.47
62 0.49
63 0.49
64 0.47
65 0.48
66 0.43
67 0.39
68 0.32
69 0.35
70 0.35
71 0.33
72 0.3
73 0.24
74 0.23
75 0.21
76 0.2
77 0.17
78 0.14
79 0.11
80 0.1
81 0.12
82 0.11
83 0.1
84 0.11
85 0.1
86 0.09
87 0.08
88 0.13
89 0.14
90 0.14
91 0.16
92 0.16
93 0.19
94 0.21
95 0.22
96 0.18
97 0.18
98 0.22
99 0.23
100 0.22
101 0.19
102 0.18
103 0.16
104 0.17
105 0.17
106 0.14
107 0.12
108 0.11
109 0.15
110 0.18
111 0.2
112 0.23
113 0.21
114 0.21
115 0.21
116 0.22
117 0.18
118 0.15
119 0.14
120 0.1
121 0.08
122 0.07
123 0.07
124 0.05
125 0.07
126 0.09
127 0.08
128 0.08
129 0.1
130 0.17
131 0.2
132 0.22
133 0.28
134 0.35
135 0.43
136 0.46
137 0.5
138 0.46
139 0.47
140 0.45
141 0.39
142 0.35
143 0.29
144 0.27
145 0.22
146 0.19
147 0.16
148 0.17
149 0.15
150 0.13
151 0.12
152 0.1
153 0.11
154 0.11
155 0.1
156 0.09
157 0.09
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.06
164 0.07
165 0.08
166 0.09
167 0.12
168 0.13
169 0.13
170 0.16
171 0.16
172 0.17
173 0.21
174 0.21
175 0.22
176 0.24
177 0.31
178 0.35
179 0.43
180 0.52
181 0.57
182 0.68
183 0.77
184 0.84
185 0.88
186 0.93
187 0.92
188 0.87
189 0.87
190 0.85
191 0.82
192 0.8
193 0.78
194 0.68
195 0.6
196 0.54
197 0.45
198 0.37
199 0.31
200 0.26
201 0.18
202 0.17
203 0.15
204 0.17
205 0.19
206 0.18
207 0.19
208 0.16
209 0.17
210 0.18
211 0.18
212 0.19
213 0.2
214 0.25
215 0.26
216 0.3
217 0.33
218 0.37
219 0.44
220 0.51
221 0.52
222 0.53
223 0.57
224 0.6
225 0.65
226 0.68
227 0.7
228 0.67
229 0.68
230 0.62
231 0.61
232 0.6
233 0.57
234 0.59
235 0.57
236 0.6
237 0.59
238 0.58
239 0.54
240 0.48
241 0.44
242 0.44
243 0.46
244 0.45
245 0.48
246 0.49
247 0.56
248 0.64
249 0.69
250 0.69
251 0.7
252 0.72
253 0.75
254 0.76
255 0.73
256 0.7
257 0.69
258 0.68
259 0.62
260 0.58
261 0.55
262 0.56
263 0.56