FuNGI

A0A2P5I2H4

Protein Details

Accession

A0A2P5I2H4

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
16-47	AALFVAQRRKPTQPKKEAKKTKAENNLKAKQL	Hydrophilic

NLS Segment(s)

Position	Sequence
23-37	RRKPTQPKKEAKKTK

Subcellular Location(s)

plas 24, E.R. 3

Family & Domain DBs

InterPro	View protein in InterPro IPR036259 MFS_trans_sf IPR008509 MOT2/MFSD5
Gene Ontology	GO:0005886 C:plasma membrane GO:0015098 F:molybdate ion transmembrane transporter activity
Pfam	View protein in Pfam PF05631 MFS_5

Amino Acid Sequences

METYQLNFTGLLGLCAALFVAQRRKPTQPKKEAKKTKAENNLKAKQLTDSNEASQWPFLIVFALGPFLYSLYREEHGVSTGTVSTLFTTGFLSGAVSAYATGTLADRHGRRLACLVFCGAYALSCALTMVPSLPLLFIGRILGGVGTSLLFSVFESWMVTDFHARGLGEKGGDLSRTFGVMSTLNSVVAIVSGVFSEWVVSVSGTRKAPFAAAVVLLAVAGWVISTRWDENYGDSARSKPKADIRNEEGEEAASRPKLWDMLKDPRIVCLGLSSTMFEGSMYLFVFMWGPALQSAHTYESASAGAATTTGLPYGIIFASFMASVLAASLLFNIAMDNKLLKYTYLLGGILALADLVFYLLEQPRSEQLTFWLFCLFEACVGMYWPCMGYLKGQLIEDGVRAQLYGILRVPLNVFVVVSLYFTGDGDSYAKVFAVCSRLLLLSIGALYAMVMNEDELP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.11
3	0.11
4	0.06
5	0.07
6	0.12
7	0.21
8	0.25
9	0.32
10	0.37
11	0.47
12	0.57
13	0.66
14	0.72
15	0.74
16	0.82
17	0.86
18	0.93
19	0.94
20	0.91
21	0.91
22	0.89
23	0.88
24	0.88
25	0.87
26	0.85
27	0.85
28	0.84
29	0.79
30	0.72
31	0.63
32	0.57
33	0.53
34	0.48
35	0.44
36	0.4
37	0.37
38	0.37
39	0.37
40	0.34
41	0.28
42	0.23
43	0.18
44	0.14
45	0.12
46	0.1
47	0.09
48	0.08
49	0.07
50	0.09
51	0.07
52	0.07
53	0.07
54	0.07
55	0.07
56	0.08
57	0.09
58	0.11
59	0.13
60	0.13
61	0.15
62	0.15
63	0.16
64	0.16
65	0.15
66	0.13
67	0.12
68	0.12
69	0.1
70	0.09
71	0.09
72	0.08
73	0.08
74	0.07
75	0.08
76	0.08
77	0.07
78	0.07
79	0.07
80	0.06
81	0.07
82	0.06
83	0.05
84	0.05
85	0.05
86	0.05
87	0.05
88	0.04
89	0.05
90	0.05
91	0.07
92	0.13
93	0.14
94	0.17
95	0.23
96	0.23
97	0.24
98	0.29
99	0.31
100	0.26
101	0.26
102	0.24
103	0.19
104	0.19
105	0.19
106	0.13
107	0.09
108	0.08
109	0.08
110	0.06
111	0.06
112	0.06
113	0.05
114	0.05
115	0.05
116	0.05
117	0.05
118	0.05
119	0.06
120	0.05
121	0.06
122	0.07
123	0.07
124	0.06
125	0.06
126	0.06
127	0.05
128	0.05
129	0.05
130	0.04
131	0.04
132	0.04
133	0.03
134	0.03
135	0.03
136	0.03
137	0.03
138	0.04
139	0.06
140	0.05
141	0.06
142	0.06
143	0.06
144	0.08
145	0.08
146	0.09
147	0.09
148	0.09
149	0.09
150	0.11
151	0.1
152	0.1
153	0.12
154	0.13
155	0.1
156	0.1
157	0.11
158	0.1
159	0.11
160	0.1
161	0.1
162	0.09
163	0.09
164	0.09
165	0.08
166	0.09
167	0.09
168	0.09
169	0.1
170	0.1
171	0.09
172	0.09
173	0.09
174	0.07
175	0.07
176	0.06
177	0.03
178	0.03
179	0.03
180	0.03
181	0.03
182	0.03
183	0.03
184	0.03
185	0.04
186	0.04
187	0.04
188	0.06
189	0.07
190	0.11
191	0.12
192	0.12
193	0.12
194	0.12
195	0.13
196	0.12
197	0.11
198	0.08
199	0.07
200	0.06
201	0.06
202	0.05
203	0.05
204	0.04
205	0.03
206	0.02
207	0.02
208	0.02
209	0.02
210	0.02
211	0.03
212	0.04
213	0.05
214	0.05
215	0.07
216	0.08
217	0.09
218	0.14
219	0.14
220	0.14
221	0.14
222	0.17
223	0.19
224	0.21
225	0.21
226	0.2
227	0.27
228	0.33
229	0.38
230	0.41
231	0.42
232	0.48
233	0.47
234	0.44
235	0.37
236	0.29
237	0.25
238	0.19
239	0.16
240	0.08
241	0.08
242	0.08
243	0.08
244	0.11
245	0.11
246	0.15
247	0.2
248	0.29
249	0.33
250	0.38
251	0.37
252	0.35
253	0.36
254	0.31
255	0.25
256	0.16
257	0.14
258	0.1
259	0.1
260	0.09
261	0.08
262	0.08
263	0.08
264	0.06
265	0.06
266	0.05
267	0.06
268	0.05
269	0.06
270	0.05
271	0.06
272	0.06
273	0.06
274	0.07
275	0.06
276	0.06
277	0.06
278	0.06
279	0.06
280	0.07
281	0.09
282	0.09
283	0.1
284	0.1
285	0.1
286	0.11
287	0.11
288	0.09
289	0.08
290	0.06
291	0.05
292	0.05
293	0.05
294	0.04
295	0.04
296	0.04
297	0.04
298	0.04
299	0.04
300	0.05
301	0.05
302	0.05
303	0.05
304	0.05
305	0.06
306	0.05
307	0.06
308	0.04
309	0.04
310	0.04
311	0.04
312	0.04
313	0.03
314	0.03
315	0.03
316	0.03
317	0.03
318	0.03
319	0.04
320	0.04
321	0.05
322	0.06
323	0.07
324	0.07
325	0.08
326	0.09
327	0.09
328	0.1
329	0.12
330	0.13
331	0.13
332	0.13
333	0.12
334	0.12
335	0.11
336	0.09
337	0.06
338	0.04
339	0.03
340	0.02
341	0.02
342	0.02
343	0.02
344	0.02
345	0.06
346	0.08
347	0.1
348	0.1
349	0.12
350	0.16
351	0.21
352	0.21
353	0.18
354	0.2
355	0.26
356	0.27
357	0.26
358	0.24
359	0.19
360	0.19
361	0.21
362	0.17
363	0.1
364	0.1
365	0.1
366	0.08
367	0.09
368	0.1
369	0.08
370	0.08
371	0.08
372	0.08
373	0.09
374	0.09
375	0.1
376	0.16
377	0.2
378	0.21
379	0.21
380	0.21
381	0.21
382	0.22
383	0.2
384	0.15
385	0.12
386	0.09
387	0.09
388	0.09
389	0.11
390	0.11
391	0.13
392	0.13
393	0.14
394	0.15
395	0.16
396	0.17
397	0.15
398	0.16
399	0.14
400	0.12
401	0.1
402	0.12
403	0.1
404	0.1
405	0.08
406	0.08
407	0.08
408	0.08
409	0.09
410	0.07
411	0.08
412	0.09
413	0.1
414	0.09
415	0.1
416	0.1
417	0.09
418	0.1
419	0.12
420	0.15
421	0.14
422	0.14
423	0.16
424	0.16
425	0.17
426	0.17
427	0.14
428	0.1
429	0.1
430	0.09
431	0.07
432	0.06
433	0.05
434	0.06
435	0.06
436	0.05
437	0.05

A0A2P5I2H4

3D AlphaFold-predicted Structure Viewer