Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5I2H4

Protein Details
Accession A0A2P5I2H4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-47AALFVAQRRKPTQPKKEAKKTKAENNLKAKQLHydrophilic
NLS Segment(s)
PositionSequence
23-37RRKPTQPKKEAKKTK
Subcellular Location(s) plas 24, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
IPR008509  MOT2/MFSD5  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015098  F:molybdate ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF05631  MFS_5  
Amino Acid Sequences METYQLNFTGLLGLCAALFVAQRRKPTQPKKEAKKTKAENNLKAKQLTDSNEASQWPFLIVFALGPFLYSLYREEHGVSTGTVSTLFTTGFLSGAVSAYATGTLADRHGRRLACLVFCGAYALSCALTMVPSLPLLFIGRILGGVGTSLLFSVFESWMVTDFHARGLGEKGGDLSRTFGVMSTLNSVVAIVSGVFSEWVVSVSGTRKAPFAAAVVLLAVAGWVISTRWDENYGDSARSKPKADIRNEEGEEAASRPKLWDMLKDPRIVCLGLSSTMFEGSMYLFVFMWGPALQSAHTYESASAGAATTTGLPYGIIFASFMASVLAASLLFNIAMDNKLLKYTYLLGGILALADLVFYLLEQPRSEQLTFWLFCLFEACVGMYWPCMGYLKGQLIEDGVRAQLYGILRVPLNVFVVVSLYFTGDGDSYAKVFAVCSRLLLLSIGALYAMVMNEDELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.06
5 0.07
6 0.12
7 0.21
8 0.25
9 0.32
10 0.37
11 0.47
12 0.57
13 0.66
14 0.72
15 0.74
16 0.82
17 0.86
18 0.93
19 0.94
20 0.91
21 0.91
22 0.89
23 0.88
24 0.88
25 0.87
26 0.85
27 0.85
28 0.84
29 0.79
30 0.72
31 0.63
32 0.57
33 0.53
34 0.48
35 0.44
36 0.4
37 0.37
38 0.37
39 0.37
40 0.34
41 0.28
42 0.23
43 0.18
44 0.14
45 0.12
46 0.1
47 0.09
48 0.08
49 0.07
50 0.09
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.11
59 0.13
60 0.13
61 0.15
62 0.15
63 0.16
64 0.16
65 0.15
66 0.13
67 0.12
68 0.12
69 0.1
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.06
81 0.07
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.07
92 0.13
93 0.14
94 0.17
95 0.23
96 0.23
97 0.24
98 0.29
99 0.31
100 0.26
101 0.26
102 0.24
103 0.19
104 0.19
105 0.19
106 0.13
107 0.09
108 0.08
109 0.08
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.05
121 0.06
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.08
145 0.08
146 0.09
147 0.09
148 0.09
149 0.09
150 0.11
151 0.1
152 0.1
153 0.12
154 0.13
155 0.1
156 0.1
157 0.11
158 0.1
159 0.11
160 0.1
161 0.1
162 0.09
163 0.09
164 0.09
165 0.08
166 0.09
167 0.09
168 0.09
169 0.1
170 0.1
171 0.09
172 0.09
173 0.09
174 0.07
175 0.07
176 0.06
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.06
189 0.07
190 0.11
191 0.12
192 0.12
193 0.12
194 0.12
195 0.13
196 0.12
197 0.11
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.05
204 0.04
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.03
212 0.04
213 0.05
214 0.05
215 0.07
216 0.08
217 0.09
218 0.14
219 0.14
220 0.14
221 0.14
222 0.17
223 0.19
224 0.21
225 0.21
226 0.2
227 0.27
228 0.33
229 0.38
230 0.41
231 0.42
232 0.48
233 0.47
234 0.44
235 0.37
236 0.29
237 0.25
238 0.19
239 0.16
240 0.08
241 0.08
242 0.08
243 0.08
244 0.11
245 0.11
246 0.15
247 0.2
248 0.29
249 0.33
250 0.38
251 0.37
252 0.35
253 0.36
254 0.31
255 0.25
256 0.16
257 0.14
258 0.1
259 0.1
260 0.09
261 0.08
262 0.08
263 0.08
264 0.06
265 0.06
266 0.05
267 0.06
268 0.05
269 0.06
270 0.05
271 0.06
272 0.06
273 0.06
274 0.07
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.07
281 0.09
282 0.09
283 0.1
284 0.1
285 0.1
286 0.11
287 0.11
288 0.09
289 0.08
290 0.06
291 0.05
292 0.05
293 0.05
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.06
306 0.05
307 0.06
308 0.04
309 0.04
310 0.04
311 0.04
312 0.04
313 0.03
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.04
320 0.04
321 0.05
322 0.06
323 0.07
324 0.07
325 0.08
326 0.09
327 0.09
328 0.1
329 0.12
330 0.13
331 0.13
332 0.13
333 0.12
334 0.12
335 0.11
336 0.09
337 0.06
338 0.04
339 0.03
340 0.02
341 0.02
342 0.02
343 0.02
344 0.02
345 0.06
346 0.08
347 0.1
348 0.1
349 0.12
350 0.16
351 0.21
352 0.21
353 0.18
354 0.2
355 0.26
356 0.27
357 0.26
358 0.24
359 0.19
360 0.19
361 0.21
362 0.17
363 0.1
364 0.1
365 0.1
366 0.08
367 0.09
368 0.1
369 0.08
370 0.08
371 0.08
372 0.08
373 0.09
374 0.09
375 0.1
376 0.16
377 0.2
378 0.21
379 0.21
380 0.21
381 0.21
382 0.22
383 0.2
384 0.15
385 0.12
386 0.09
387 0.09
388 0.09
389 0.11
390 0.11
391 0.13
392 0.13
393 0.14
394 0.15
395 0.16
396 0.17
397 0.15
398 0.16
399 0.14
400 0.12
401 0.1
402 0.12
403 0.1
404 0.1
405 0.08
406 0.08
407 0.08
408 0.08
409 0.09
410 0.07
411 0.08
412 0.09
413 0.1
414 0.09
415 0.1
416 0.1
417 0.09
418 0.1
419 0.12
420 0.15
421 0.14
422 0.14
423 0.16
424 0.16
425 0.17
426 0.17
427 0.14
428 0.1
429 0.1
430 0.09
431 0.07
432 0.06
433 0.05
434 0.06
435 0.06
436 0.05
437 0.05