Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AVS1

Protein Details
Accession H2AVS1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-64GSTYNLKPKNKTKSKSKSKTKHKNASNCSVRSHydrophilic
NLS Segment(s)
PositionSequence
39-55KPKNKTKSKSKSKTKHK
Subcellular Location(s) nucl 19, cyto_nucl 15.5, cyto 8
Family & Domain DBs
KEGG kaf:KAFR_0E03190  -  
Pfam View protein in Pfam  
PF17242  DUF5315  
Amino Acid Sequences MDANSQSNSTSETFQLHNFSKESTPDGIQSTPGSTYNLKPKNKTKSKSKSKTKHKNASNCSVRSSSNLAIRGKSPKNLLSASSEENGFKTSKNASKHGTPKPDSSIASPWSAIDTLDDVKMMAAENKFTDVLPPKFEVDLQCTREAHVQLLNAMRDRKSRLQRPIDKEGADETVLPKFFETRTSTTEELEPIYVSDYTETKDSFKEITKQEEEYVRLMEDTITGVQNLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.27
4 0.28
5 0.27
6 0.28
7 0.28
8 0.28
9 0.29
10 0.26
11 0.25
12 0.24
13 0.26
14 0.24
15 0.23
16 0.22
17 0.2
18 0.18
19 0.17
20 0.18
21 0.18
22 0.22
23 0.3
24 0.38
25 0.42
26 0.47
27 0.55
28 0.64
29 0.71
30 0.74
31 0.75
32 0.77
33 0.84
34 0.87
35 0.9
36 0.89
37 0.9
38 0.94
39 0.94
40 0.93
41 0.91
42 0.9
43 0.86
44 0.86
45 0.84
46 0.74
47 0.67
48 0.59
49 0.51
50 0.44
51 0.41
52 0.34
53 0.3
54 0.35
55 0.31
56 0.3
57 0.32
58 0.37
59 0.35
60 0.34
61 0.33
62 0.3
63 0.32
64 0.32
65 0.31
66 0.27
67 0.27
68 0.27
69 0.24
70 0.22
71 0.18
72 0.18
73 0.18
74 0.14
75 0.11
76 0.11
77 0.15
78 0.2
79 0.23
80 0.26
81 0.28
82 0.35
83 0.43
84 0.47
85 0.5
86 0.48
87 0.47
88 0.47
89 0.47
90 0.41
91 0.35
92 0.32
93 0.26
94 0.24
95 0.21
96 0.17
97 0.14
98 0.13
99 0.11
100 0.07
101 0.07
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.07
110 0.06
111 0.07
112 0.07
113 0.08
114 0.09
115 0.08
116 0.12
117 0.15
118 0.17
119 0.18
120 0.19
121 0.19
122 0.19
123 0.21
124 0.19
125 0.19
126 0.24
127 0.25
128 0.26
129 0.25
130 0.26
131 0.29
132 0.28
133 0.23
134 0.19
135 0.16
136 0.16
137 0.19
138 0.19
139 0.18
140 0.19
141 0.2
142 0.21
143 0.26
144 0.33
145 0.39
146 0.46
147 0.53
148 0.61
149 0.69
150 0.74
151 0.77
152 0.73
153 0.64
154 0.57
155 0.49
156 0.4
157 0.31
158 0.25
159 0.17
160 0.17
161 0.17
162 0.15
163 0.14
164 0.13
165 0.13
166 0.18
167 0.22
168 0.22
169 0.25
170 0.3
171 0.31
172 0.31
173 0.32
174 0.28
175 0.24
176 0.21
177 0.18
178 0.12
179 0.13
180 0.12
181 0.1
182 0.11
183 0.1
184 0.11
185 0.14
186 0.15
187 0.14
188 0.15
189 0.17
190 0.18
191 0.22
192 0.28
193 0.3
194 0.37
195 0.39
196 0.4
197 0.43
198 0.45
199 0.43
200 0.38
201 0.35
202 0.28
203 0.24
204 0.22
205 0.18
206 0.13
207 0.13
208 0.13
209 0.12