Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5HZ94

Protein Details
Accession A0A2P5HZ94    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-109AEVLSKKEKREKEKGDDDKKNGBasic
NLS Segment(s)
PositionSequence
94-101KEKREKEK
Subcellular Location(s) cyto 15, mito 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038814  AIM11  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFQPSHHGPGIPPRGQRDKGDDAFVAAEALGLATLNVFSFGVMMTGGFMWAFDISNIEDLRRKARASLYGVNGVVDSAAEQQVEEWIAEVLSKKEKREKEKGDDDKKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.56
4 0.53
5 0.53
6 0.5
7 0.5
8 0.42
9 0.35
10 0.32
11 0.28
12 0.21
13 0.12
14 0.09
15 0.05
16 0.05
17 0.04
18 0.03
19 0.03
20 0.02
21 0.03
22 0.02
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.03
40 0.04
41 0.04
42 0.07
43 0.07
44 0.07
45 0.1
46 0.11
47 0.14
48 0.16
49 0.16
50 0.15
51 0.18
52 0.23
53 0.26
54 0.31
55 0.3
56 0.32
57 0.32
58 0.3
59 0.27
60 0.21
61 0.15
62 0.09
63 0.07
64 0.05
65 0.06
66 0.06
67 0.05
68 0.06
69 0.07
70 0.08
71 0.07
72 0.06
73 0.05
74 0.05
75 0.06
76 0.08
77 0.09
78 0.18
79 0.21
80 0.25
81 0.34
82 0.42
83 0.51
84 0.6
85 0.67
86 0.68
87 0.76
88 0.82
89 0.84