Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P5IG05

Protein Details
Accession A0A2P5IG05    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
32-51KSFRTKQKLAKAKKQNRPIPHydrophilic
57-78RTDNTIRYNAKRRHWRKTRLGIHydrophilic
NLS Segment(s)
PositionSequence
36-49TKQKLAKAKKQNRP
67-74KRRHWRKT
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MCIRKSWAWPAPGPAGRAAIPLGNSGLIISHKSFRTKQKLAKAKKQNRPIPQWIRLRTDNTIRYNAKRRHWRKTRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.29
4 0.28
5 0.23
6 0.16
7 0.13
8 0.12
9 0.11
10 0.09
11 0.08
12 0.07
13 0.07
14 0.07
15 0.08
16 0.08
17 0.11
18 0.13
19 0.17
20 0.21
21 0.29
22 0.37
23 0.42
24 0.47
25 0.53
26 0.61
27 0.65
28 0.71
29 0.73
30 0.75
31 0.77
32 0.81
33 0.8
34 0.78
35 0.79
36 0.79
37 0.77
38 0.75
39 0.75
40 0.7
41 0.68
42 0.64
43 0.6
44 0.55
45 0.55
46 0.54
47 0.49
48 0.53
49 0.51
50 0.54
51 0.61
52 0.63
53 0.65
54 0.69
55 0.72
56 0.75
57 0.81
58 0.84