Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PX60

Protein Details
Accession A0A1E3PX60    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-87DADPEKKARKEWRKKNREKIKQGNFLKSMRBasic
NLS Segment(s)
PositionSequence
59-80ADPEKKARKEWRKKNREKIKQG
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MIIIARDETELSSAPAGTRLRGCNILKSGQDPEALPDNEYPDWLWELLDDEAQKRKLDADPEKKARKEWRKKNREKIKQGNFLKSMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.15
4 0.15
5 0.19
6 0.19
7 0.22
8 0.29
9 0.3
10 0.3
11 0.33
12 0.34
13 0.31
14 0.32
15 0.31
16 0.26
17 0.26
18 0.2
19 0.2
20 0.23
21 0.22
22 0.21
23 0.18
24 0.2
25 0.18
26 0.18
27 0.16
28 0.1
29 0.1
30 0.09
31 0.08
32 0.05
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.13
39 0.15
40 0.15
41 0.13
42 0.15
43 0.17
44 0.25
45 0.33
46 0.38
47 0.46
48 0.56
49 0.63
50 0.62
51 0.67
52 0.69
53 0.71
54 0.72
55 0.74
56 0.76
57 0.8
58 0.89
59 0.94
60 0.94
61 0.94
62 0.94
63 0.94
64 0.94
65 0.93
66 0.89
67 0.87