Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PUW6

Protein Details
Accession A0A1E3PUW6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-91ANNLRSIIKKHTNRTKGKRVVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.333, nucl 13.5, cyto 10, cyto_mito 7.665
Family & Domain DBs
Amino Acid Sequences RTPTEFDIFDQVVVNSSPPDATSLRSANELLNSAINSDAIPTTPVRRYIRKLTAGAGQLQARSIVHQHDANNLRSIIKKHTNRTKGKRVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.09
3 0.09
4 0.09
5 0.08
6 0.11
7 0.1
8 0.11
9 0.16
10 0.17
11 0.17
12 0.19
13 0.19
14 0.17
15 0.18
16 0.17
17 0.13
18 0.12
19 0.11
20 0.1
21 0.1
22 0.09
23 0.07
24 0.07
25 0.06
26 0.05
27 0.06
28 0.06
29 0.09
30 0.1
31 0.17
32 0.2
33 0.23
34 0.28
35 0.34
36 0.4
37 0.42
38 0.41
39 0.37
40 0.39
41 0.37
42 0.34
43 0.29
44 0.23
45 0.19
46 0.18
47 0.17
48 0.12
49 0.11
50 0.11
51 0.1
52 0.13
53 0.15
54 0.16
55 0.24
56 0.29
57 0.3
58 0.32
59 0.3
60 0.29
61 0.3
62 0.32
63 0.32
64 0.38
65 0.43
66 0.5
67 0.6
68 0.68
69 0.75
70 0.83
71 0.85