Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QG12

Protein Details
Accession A0A1E3QG12    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-113GRPLWDRDPRPRSRTRIPRTRLBasic
NLS Segment(s)
PositionSequence
72-112ERERERDRERERDRERDRDYGRPLWDRDPRPRSRTRIPRTR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPPSPPSPTGPYHPLQRPSSNVSQHHIPPLAISSSLSSSGPFHFPSGPRSALYSKPGIYRTDRERDYRWERERERERDRERERDRERDRDYGRPLWDRDPRPRSRTRIPRTRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.53
4 0.52
5 0.54
6 0.57
7 0.56
8 0.51
9 0.48
10 0.48
11 0.46
12 0.46
13 0.4
14 0.32
15 0.25
16 0.25
17 0.21
18 0.16
19 0.15
20 0.11
21 0.11
22 0.12
23 0.11
24 0.1
25 0.1
26 0.11
27 0.13
28 0.12
29 0.12
30 0.14
31 0.15
32 0.18
33 0.21
34 0.2
35 0.19
36 0.21
37 0.22
38 0.22
39 0.23
40 0.22
41 0.19
42 0.21
43 0.23
44 0.22
45 0.22
46 0.25
47 0.28
48 0.33
49 0.35
50 0.35
51 0.36
52 0.43
53 0.48
54 0.52
55 0.53
56 0.55
57 0.55
58 0.62
59 0.69
60 0.68
61 0.69
62 0.69
63 0.69
64 0.71
65 0.74
66 0.74
67 0.71
68 0.74
69 0.72
70 0.73
71 0.73
72 0.72
73 0.71
74 0.7
75 0.68
76 0.65
77 0.65
78 0.61
79 0.61
80 0.57
81 0.55
82 0.54
83 0.59
84 0.58
85 0.62
86 0.65
87 0.68
88 0.69
89 0.75
90 0.74
91 0.76
92 0.81
93 0.81