Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3Q5Z5

Protein Details
Accession A0A1E3Q5Z5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-74SIFPDYKYCPHRSKRKRRDDAMDNEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MRNSASADTRMVNTAKVQSAIAMIWRRVPPELKSLFILMQKESAALHSSIFPDYKYCPHRSKRKRRDDAMDNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.18
5 0.15
6 0.15
7 0.14
8 0.17
9 0.16
10 0.15
11 0.19
12 0.19
13 0.2
14 0.21
15 0.24
16 0.2
17 0.26
18 0.27
19 0.24
20 0.24
21 0.24
22 0.24
23 0.23
24 0.22
25 0.14
26 0.14
27 0.12
28 0.11
29 0.1
30 0.09
31 0.09
32 0.08
33 0.08
34 0.09
35 0.1
36 0.11
37 0.11
38 0.11
39 0.11
40 0.13
41 0.2
42 0.25
43 0.31
44 0.38
45 0.47
46 0.59
47 0.68
48 0.77
49 0.81
50 0.86
51 0.9
52 0.9
53 0.91
54 0.9