Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3Q0N8

Protein Details
Accession A0A1E3Q0N8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-84QPSTVKRKRHYGFRARLKTKNGRRILMRRKEKGRWYLSHBasic
NLS Segment(s)
PositionSequence
51-79KRKRHYGFRARLKTKNGRRILMRRKEKGR
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPSTSVPSTASSSLLSLPSSILPPMGSAVFPQFGQRRWKARGNTYQPSTVKRKRHYGFRARLKTKNGRRILMRRKEKGRWYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.11
4 0.11
5 0.1
6 0.11
7 0.1
8 0.09
9 0.08
10 0.08
11 0.09
12 0.08
13 0.07
14 0.07
15 0.08
16 0.09
17 0.09
18 0.13
19 0.14
20 0.18
21 0.25
22 0.29
23 0.34
24 0.38
25 0.45
26 0.44
27 0.5
28 0.56
29 0.57
30 0.58
31 0.55
32 0.57
33 0.51
34 0.53
35 0.54
36 0.52
37 0.52
38 0.5
39 0.58
40 0.55
41 0.64
42 0.69
43 0.7
44 0.73
45 0.76
46 0.82
47 0.77
48 0.8
49 0.78
50 0.79
51 0.78
52 0.78
53 0.73
54 0.69
55 0.71
56 0.76
57 0.78
58 0.78
59 0.79
60 0.78
61 0.81
62 0.84
63 0.84
64 0.83