Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QDA6

Protein Details
Accession A0A1E3QDA6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-115LDLRVKKTRALRRQLTKHQKSLKTEKEKKKLIAFPHydrophilic
NLS Segment(s)
PositionSequence
84-118RVKKTRALRRQLTKHQKSLKTEKEKKKLIAFPQRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGVKAYALREKSKADLEAQLVELKQELASLKAQKARGASASNLIRMHTVRKSIARVLTVINQQQRAQLRLFYKGKKYIPLDLRVKKTRALRRQLTKHQKSLKTEKEKKKLIAFPQRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.32
4 0.31
5 0.29
6 0.28
7 0.26
8 0.22
9 0.2
10 0.17
11 0.13
12 0.1
13 0.1
14 0.09
15 0.09
16 0.13
17 0.16
18 0.19
19 0.24
20 0.25
21 0.26
22 0.27
23 0.26
24 0.25
25 0.24
26 0.22
27 0.24
28 0.25
29 0.26
30 0.25
31 0.23
32 0.21
33 0.2
34 0.23
35 0.17
36 0.18
37 0.18
38 0.2
39 0.22
40 0.24
41 0.25
42 0.22
43 0.21
44 0.2
45 0.21
46 0.21
47 0.23
48 0.22
49 0.21
50 0.21
51 0.24
52 0.24
53 0.22
54 0.2
55 0.21
56 0.2
57 0.27
58 0.31
59 0.31
60 0.35
61 0.39
62 0.4
63 0.43
64 0.44
65 0.44
66 0.45
67 0.49
68 0.53
69 0.54
70 0.6
71 0.59
72 0.58
73 0.55
74 0.59
75 0.6
76 0.61
77 0.63
78 0.65
79 0.69
80 0.77
81 0.83
82 0.86
83 0.83
84 0.83
85 0.83
86 0.81
87 0.79
88 0.8
89 0.79
90 0.79
91 0.82
92 0.84
93 0.84
94 0.85
95 0.83
96 0.82
97 0.79
98 0.78
99 0.79
100 0.78
101 0.74
102 0.76
103 0.77