Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YY01

Protein Details
Accession C7YY01   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-81KLDIAITKPRRDKKFKKHFKKGLSKKSSKKKPSKRKSSKKKSSKKKSSKKNSSKKRTAEQEBasic
NLS Segment(s)
PositionSequence
27-76TKPRRDKKFKKHFKKGLSKKSSKKKPSKRKSSKKKSSKKKSSKKNSSKKR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
KEGG nhe:NECHADRAFT_82708  -  
Amino Acid Sequences MLTLETRPVRPAEGFVGVRPKLDIAITKPRRDKKFKKHFKKGLSKKSSKKKPSKRKSSKKKSSKKKSSKKNSSKKRTAEQEADDRVYLSEGPSSKDQKERKPKTPVPTPPWSVRALSWLAGGHPVKVVYRVKEVAKPKTDDPKADDPTKGGSDKPTEEEPEKPAEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.34
4 0.31
5 0.31
6 0.29
7 0.25
8 0.19
9 0.2
10 0.21
11 0.18
12 0.29
13 0.35
14 0.42
15 0.5
16 0.58
17 0.66
18 0.73
19 0.78
20 0.78
21 0.83
22 0.87
23 0.9
24 0.92
25 0.92
26 0.92
27 0.93
28 0.92
29 0.92
30 0.91
31 0.89
32 0.88
33 0.9
34 0.9
35 0.89
36 0.89
37 0.89
38 0.9
39 0.91
40 0.93
41 0.94
42 0.95
43 0.95
44 0.96
45 0.96
46 0.95
47 0.95
48 0.95
49 0.95
50 0.95
51 0.94
52 0.93
53 0.93
54 0.93
55 0.94
56 0.94
57 0.93
58 0.93
59 0.92
60 0.91
61 0.86
62 0.82
63 0.79
64 0.74
65 0.68
66 0.61
67 0.57
68 0.51
69 0.46
70 0.38
71 0.3
72 0.24
73 0.19
74 0.15
75 0.08
76 0.08
77 0.08
78 0.1
79 0.14
80 0.17
81 0.18
82 0.26
83 0.31
84 0.38
85 0.49
86 0.54
87 0.59
88 0.66
89 0.7
90 0.7
91 0.75
92 0.75
93 0.71
94 0.71
95 0.68
96 0.61
97 0.58
98 0.52
99 0.43
100 0.34
101 0.31
102 0.24
103 0.2
104 0.17
105 0.14
106 0.13
107 0.18
108 0.18
109 0.14
110 0.14
111 0.14
112 0.13
113 0.19
114 0.22
115 0.19
116 0.24
117 0.27
118 0.29
119 0.35
120 0.42
121 0.45
122 0.48
123 0.49
124 0.5
125 0.57
126 0.58
127 0.55
128 0.56
129 0.57
130 0.57
131 0.57
132 0.52
133 0.43
134 0.44
135 0.44
136 0.38
137 0.3
138 0.29
139 0.3
140 0.32
141 0.35
142 0.35
143 0.36
144 0.38
145 0.4
146 0.38
147 0.39