Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QDA1

Protein Details
Accession A0A1E3QDA1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-86LIYKLPEKDHKEKNQRSNENTDKHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 6, plas 5, golg 5, mito 4, extr 4, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKYGVHIWSCCILNVFSVHITSIIRKGSFPQNAPSIVHPLNLCAVLYFIIMLSLFVRAWPPPSLIYKLPEKDHKEKNQRSNENTDKAAEQQLEHKRSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.13
4 0.13
5 0.12
6 0.12
7 0.12
8 0.12
9 0.14
10 0.16
11 0.15
12 0.15
13 0.19
14 0.26
15 0.31
16 0.31
17 0.32
18 0.32
19 0.33
20 0.34
21 0.32
22 0.29
23 0.24
24 0.24
25 0.19
26 0.17
27 0.16
28 0.15
29 0.13
30 0.07
31 0.07
32 0.06
33 0.05
34 0.05
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.08
46 0.08
47 0.1
48 0.11
49 0.14
50 0.18
51 0.19
52 0.22
53 0.27
54 0.29
55 0.33
56 0.39
57 0.44
58 0.49
59 0.56
60 0.63
61 0.68
62 0.73
63 0.79
64 0.82
65 0.82
66 0.8
67 0.8
68 0.78
69 0.72
70 0.65
71 0.57
72 0.48
73 0.42
74 0.42
75 0.33
76 0.26
77 0.3
78 0.38
79 0.42