Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q7L3

Protein Details
Accession A0A1E3Q7L3   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27YSCSYSWCPKKFPRKDSRNRHEKLVHHydrophilic
NLS Segment(s)
PositionSequence
11-79KKFPRKDSRNRHEKLVHEKPDSRLNRKLEKKRMEDEAKARRLAEVNPSAGVARFKSMLKKKKSISRLAN
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MYSCSYSWCPKKFPRKDSRNRHEKLVHEKPDSRLNRKLEKKRMEDEAKARRLAEVNPSAGVARFKSMLKKKKSISRLANR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.87
4 0.91
5 0.92
6 0.91
7 0.84
8 0.82
9 0.76
10 0.72
11 0.71
12 0.7
13 0.67
14 0.61
15 0.62
16 0.57
17 0.61
18 0.6
19 0.55
20 0.52
21 0.5
22 0.55
23 0.6
24 0.67
25 0.67
26 0.69
27 0.69
28 0.65
29 0.68
30 0.63
31 0.58
32 0.58
33 0.58
34 0.53
35 0.49
36 0.46
37 0.39
38 0.36
39 0.32
40 0.31
41 0.25
42 0.23
43 0.22
44 0.22
45 0.21
46 0.21
47 0.21
48 0.14
49 0.12
50 0.13
51 0.14
52 0.24
53 0.33
54 0.41
55 0.47
56 0.55
57 0.61
58 0.69
59 0.76
60 0.77