Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PYZ3

Protein Details
Accession A0A1E3PYZ3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-104QVPGPARHPKKLQRKAPPVSHydrophilic
NLS Segment(s)
PositionSequence
92-99HPKKLQRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSHSVVQSSPPDTPLEIPNAQSSPAKLPKPIDVAPAPVSPVRRRVSVKKVLNNMVSRVTGQSGYTPVATIQSEVHTVTRKPVTQQVPGPARHPKKLQRKAPPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.22
4 0.22
5 0.24
6 0.24
7 0.24
8 0.22
9 0.22
10 0.23
11 0.29
12 0.29
13 0.29
14 0.3
15 0.33
16 0.38
17 0.37
18 0.34
19 0.28
20 0.3
21 0.3
22 0.28
23 0.25
24 0.21
25 0.23
26 0.2
27 0.26
28 0.25
29 0.27
30 0.31
31 0.36
32 0.42
33 0.49
34 0.54
35 0.53
36 0.56
37 0.56
38 0.57
39 0.51
40 0.44
41 0.36
42 0.29
43 0.24
44 0.19
45 0.16
46 0.11
47 0.1
48 0.1
49 0.09
50 0.1
51 0.09
52 0.09
53 0.08
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.12
62 0.14
63 0.14
64 0.18
65 0.22
66 0.22
67 0.24
68 0.32
69 0.35
70 0.38
71 0.42
72 0.47
73 0.49
74 0.49
75 0.51
76 0.53
77 0.54
78 0.54
79 0.58
80 0.59
81 0.64
82 0.73
83 0.78
84 0.79