Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QEM5

Protein Details
Accession A0A1E3QEM5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
123-146VSTVKKNSTTRRKLRPSRVNWILSHydrophilic
NLS Segment(s)
PositionSequence
70-86SFKPKKLHGGKDNREAK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MNLCLLKSFFAHLTTFYSDALPSLLSTPNMPVRDVFKALTHFRLQREALSEGSTDSAYTVSVKQGHKPSSFKPKKLHGGKDNREAKKNLKCTHCGRRYHEAKDCRIKKYQLRQIENAQQQGHVSTVKKNSTTRRKLRPSRVNWILSLLLPSAGFRPEATWLMYPLRKLLGVPKSVMSERGCWRSANLCFPVPIRPSALCRDLGLKAETPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.19
5 0.17
6 0.16
7 0.15
8 0.11
9 0.09
10 0.1
11 0.11
12 0.11
13 0.12
14 0.16
15 0.21
16 0.22
17 0.22
18 0.21
19 0.23
20 0.27
21 0.28
22 0.25
23 0.22
24 0.27
25 0.29
26 0.32
27 0.33
28 0.34
29 0.34
30 0.39
31 0.36
32 0.33
33 0.35
34 0.32
35 0.27
36 0.24
37 0.23
38 0.17
39 0.17
40 0.15
41 0.1
42 0.08
43 0.07
44 0.06
45 0.07
46 0.08
47 0.09
48 0.15
49 0.16
50 0.22
51 0.28
52 0.34
53 0.37
54 0.39
55 0.42
56 0.48
57 0.54
58 0.54
59 0.54
60 0.57
61 0.63
62 0.68
63 0.71
64 0.69
65 0.73
66 0.73
67 0.77
68 0.78
69 0.71
70 0.68
71 0.62
72 0.6
73 0.57
74 0.6
75 0.56
76 0.51
77 0.54
78 0.56
79 0.64
80 0.64
81 0.62
82 0.6
83 0.63
84 0.64
85 0.64
86 0.65
87 0.59
88 0.59
89 0.62
90 0.61
91 0.54
92 0.54
93 0.53
94 0.53
95 0.57
96 0.58
97 0.57
98 0.57
99 0.57
100 0.58
101 0.62
102 0.58
103 0.52
104 0.44
105 0.35
106 0.3
107 0.27
108 0.22
109 0.16
110 0.13
111 0.14
112 0.18
113 0.2
114 0.23
115 0.27
116 0.36
117 0.45
118 0.54
119 0.58
120 0.64
121 0.72
122 0.79
123 0.85
124 0.86
125 0.82
126 0.82
127 0.81
128 0.73
129 0.63
130 0.56
131 0.46
132 0.36
133 0.31
134 0.2
135 0.13
136 0.1
137 0.11
138 0.09
139 0.08
140 0.08
141 0.07
142 0.08
143 0.1
144 0.12
145 0.14
146 0.14
147 0.15
148 0.2
149 0.22
150 0.21
151 0.2
152 0.2
153 0.17
154 0.17
155 0.23
156 0.24
157 0.25
158 0.27
159 0.27
160 0.3
161 0.31
162 0.35
163 0.29
164 0.29
165 0.33
166 0.37
167 0.36
168 0.33
169 0.35
170 0.38
171 0.39
172 0.41
173 0.38
174 0.34
175 0.34
176 0.35
177 0.4
178 0.35
179 0.33
180 0.29
181 0.28
182 0.31
183 0.36
184 0.38
185 0.32
186 0.31
187 0.33
188 0.31
189 0.32
190 0.31