Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3Q8W5

Protein Details
Accession A0A1E3Q8W5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-86CTAKLQAHKKRHYVKSKPQLLRFGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR007727  Spo12  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MSSQQPPDFISALQHQHQQQHHAEVQPLHASESQNLQRHVLHQKIFEARTSFASPTDNLMSPCTAKLQAHKKRHYVKSKPQLLRFGSLASAANKENSGENSGLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.38
4 0.4
5 0.42
6 0.39
7 0.4
8 0.41
9 0.38
10 0.38
11 0.32
12 0.32
13 0.29
14 0.26
15 0.22
16 0.21
17 0.2
18 0.18
19 0.24
20 0.28
21 0.29
22 0.3
23 0.29
24 0.27
25 0.3
26 0.35
27 0.33
28 0.28
29 0.25
30 0.28
31 0.31
32 0.31
33 0.29
34 0.24
35 0.21
36 0.22
37 0.23
38 0.2
39 0.16
40 0.16
41 0.14
42 0.15
43 0.16
44 0.14
45 0.13
46 0.13
47 0.13
48 0.13
49 0.13
50 0.12
51 0.12
52 0.11
53 0.18
54 0.28
55 0.37
56 0.46
57 0.52
58 0.6
59 0.68
60 0.77
61 0.8
62 0.79
63 0.8
64 0.81
65 0.86
66 0.84
67 0.8
68 0.79
69 0.71
70 0.66
71 0.56
72 0.46
73 0.36
74 0.3
75 0.27
76 0.2
77 0.2
78 0.17
79 0.17
80 0.16
81 0.17
82 0.18
83 0.18
84 0.2
85 0.18